Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6706.t1
Gene name
Locationscaffold_18:284734..286911
Strand-
Gene length (bp)2177
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01293 PEPCK_ATP Phosphoenolpyruvate carboxykinase 1.5E-206 42 528

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006094 gluconeogenesis Yes
GO:0004612 phosphoenolpyruvate carboxykinase (ATP) activity Yes
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0004611 phosphoenolpyruvate carboxykinase activity No
GO:0006006 glucose metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0044283 small molecule biosynthetic process No
GO:0016830 carbon-carbon lyase activity No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0016829 lyase activity No
GO:1901363 heterocyclic compound binding No
GO:0016051 carbohydrate biosynthetic process No
GO:0000166 nucleotide binding No
GO:0005975 carbohydrate metabolic process No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0046364 monosaccharide biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0019319 hexose biosynthetic process No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0005996 monosaccharide metabolic process No
GO:0019318 hexose metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6706.t1
MVATSVNRTALHPGGVQPSKGHTELEEELHETAHIDYDRVSIIANPSVPALYEDALVYETGTAVTSSGALSAYSG
AKTGRSPSDKRVVQEASSESDIWWGPVNKPMTLDHTLADGPEEIHLDPLHMHREVWRINRERAVDYLNTRNRIYV
IDGYAGWDKRYQISVRVVCARAYHALFMRNMLIRPSREELEHFHPDYVIYNAGSFPANRFTEGMTSATSVAINFA
DKEMVILGTEYAGEMKKGVFTVLYYEMPVKHNVLTLHSSANQGPDGDVTVFFGLSGTGKTTLSADTKRQLIGDDE
HCWTDTGVFNIEGGCYAKCIGLSAEKEPDIFNAIRFGSVLENTVFDPVSRVVDYDDATLTENTRCAYPIEYIDNA
KIPCVSDNHPSNIILLTCDARGVLPPISKLTPEQTMFHFISGYTSKMAGTEDGVTEPQATFSSCFAQPFLALHPM
RYAHMLAEKIKQHKVNAWLLNTGWVGAGATTGGKRCPLKYTRAILDSIHSGELAKAEYENYATFNLPVPTSCAGV
PSELLNPEKSWTASTSFKDEVTKLAVLFNENFQKYSDEATPDVLAAAPQV*
Coding >Pro_DTO377G3_2|g6706.t1
ATGGTTGCCACATCTGTGAATCGCACTGCCTTGCACCCCGGCGGTGTTCAGCCTAGCAAGGGTCACACCGAGCTT
GAGGAGGAGCTTCACGAGACTGCTCACATTGACTACGACCGTGTCTCCATTATTGCTAACCCCTCTGTTCCTGCC
CTTTACGAAGATGCTCTTGTCTACGAGACTGGTACTGCTGTTACCTCCAGCGGTGCTTTGAGCGCATACTCCGGT
GCTAAGACTGGTCGTTCCCCCTCCGACAAGCGTGTCGTCCAGGAGGCTTCCTCAGAAAGCGATATCTGGTGGGGA
CCCGTAAATAAGCCCATGACACTGGATCACACCCTTGCAGATGGGCCCGAGGAGATCCACTTGGATCCCTTGCAT
ATGCATCGGGAGGTCTGGCGTATCAACCGTGAGCGTGCTGTCGACTACCTGAACACCCGTAACCGCATCTATGTT
ATCGATGGTTACGCCGGCTGGGACAAACGCTACCAGATCAGCGTTCGCGTTGTCTGCGCTCGCGCCTACCACGCT
CTCTTCATGCGCAACATGCTGATTCGCCCCAGCCGCGAGGAGCTCGAGCACTTCCACCCCGACTATGTTATCTAC
AATGCTGGCTCTTTCCCTGCCAACCGCTTCACTGAGGGTATGACCTCTGCCACATCCGTGGCCATCAACTTTGCC
GATAAGGAGATGGTTATCCTTGGTACCGAGTACGCTGGTGAGATGAAGAAGGGTGTCTTCACCGTTCTCTACTAC
GAGATGCCCGTCAAGCACAACGTCCTTACTCTTCACTCCTCTGCCAACCAGGGTCCGGATGGTGATGTTACCGTC
TTCTTCGGTCTGTCTGGTACTGGCAAGACCACCTTGTCCGCTGATACTAAGCGCCAGCTGATCGGTGACGACGAG
CACTGCTGGACTGACACCGGTGTCTTCAACATTGAGGGTGGTTGCTACGCCAAGTGCATTGGTCTCTCCGCCGAG
AAGGAGCCCGATATTTTCAACGCCATCCGCTTCGGCTCCGTTCTTGAGAACACCGTTTTCGACCCCGTCTCCCGC
GTTGTTGACTACGATGATGCCACCCTTACCGAGAACACCCGTTGCGCCTACCCTATTGAGTACATCGACAACGCC
AAGATTCCCTGTGTCAGCGACAACCACCCCAGCAACATCATTCTGCTCACCTGTGATGCCCGCGGTGTCCTGCCT
CCCATTTCCAAGCTCACCCCGGAGCAGACCATGTTCCACTTCATCTCCGGTTACACCTCCAAGATGGCTGGTACT
GAGGATGGTGTCACTGAGCCCCAGGCTACCTTCTCTTCTTGCTTCGCTCAGCCCTTCTTGGCTCTTCACCCCATG
CGCTACGCTCACATGTTGGCCGAGAAGATTAAGCAGCACAAGGTTAACGCCTGGCTCCTGAACACCGGTTGGGTT
GGCGCTGGCGCCACCACTGGCGGCAAGCGTTGCCCTCTCAAGTACACTCGTGCCATTCTGGATTCCATCCACAGC
GGCGAGCTGGCCAAGGCTGAGTACGAGAACTACGCTACCTTCAACCTGCCCGTGCCTACTTCCTGCGCCGGTGTC
CCCAGCGAGCTCCTTAACCCTGAGAAGAGCTGGACCGCCTCCACTTCCTTCAAGGATGAGGTCACCAAACTTGCT
GTCCTCTTCAACGAGAACTTCCAGAAGTACTCTGATGAGGCCACCCCCGATGTCCTCGCCGCCGCCCCTCAAGTT
TAG
Transcript >Pro_DTO377G3_2|g6706.t1
ATGGTTGCCACATCTGTGAATCGCACTGCCTTGCACCCCGGCGGTGTTCAGCCTAGCAAGGGTCACACCGAGCTT
GAGGAGGAGCTTCACGAGACTGCTCACATTGACTACGACCGTGTCTCCATTATTGCTAACCCCTCTGTTCCTGCC
CTTTACGAAGATGCTCTTGTCTACGAGACTGGTACTGCTGTTACCTCCAGCGGTGCTTTGAGCGCATACTCCGGT
GCTAAGACTGGTCGTTCCCCCTCCGACAAGCGTGTCGTCCAGGAGGCTTCCTCAGAAAGCGATATCTGGTGGGGA
CCCGTAAATAAGCCCATGACACTGGATCACACCCTTGCAGATGGGCCCGAGGAGATCCACTTGGATCCCTTGCAT
ATGCATCGGGAGGTCTGGCGTATCAACCGTGAGCGTGCTGTCGACTACCTGAACACCCGTAACCGCATCTATGTT
ATCGATGGTTACGCCGGCTGGGACAAACGCTACCAGATCAGCGTTCGCGTTGTCTGCGCTCGCGCCTACCACGCT
CTCTTCATGCGCAACATGCTGATTCGCCCCAGCCGCGAGGAGCTCGAGCACTTCCACCCCGACTATGTTATCTAC
AATGCTGGCTCTTTCCCTGCCAACCGCTTCACTGAGGGTATGACCTCTGCCACATCCGTGGCCATCAACTTTGCC
GATAAGGAGATGGTTATCCTTGGTACCGAGTACGCTGGTGAGATGAAGAAGGGTGTCTTCACCGTTCTCTACTAC
GAGATGCCCGTCAAGCACAACGTCCTTACTCTTCACTCCTCTGCCAACCAGGGTCCGGATGGTGATGTTACCGTC
TTCTTCGGTCTGTCTGGTACTGGCAAGACCACCTTGTCCGCTGATACTAAGCGCCAGCTGATCGGTGACGACGAG
CACTGCTGGACTGACACCGGTGTCTTCAACATTGAGGGTGGTTGCTACGCCAAGTGCATTGGTCTCTCCGCCGAG
AAGGAGCCCGATATTTTCAACGCCATCCGCTTCGGCTCCGTTCTTGAGAACACCGTTTTCGACCCCGTCTCCCGC
GTTGTTGACTACGATGATGCCACCCTTACCGAGAACACCCGTTGCGCCTACCCTATTGAGTACATCGACAACGCC
AAGATTCCCTGTGTCAGCGACAACCACCCCAGCAACATCATTCTGCTCACCTGTGATGCCCGCGGTGTCCTGCCT
CCCATTTCCAAGCTCACCCCGGAGCAGACCATGTTCCACTTCATCTCCGGTTACACCTCCAAGATGGCTGGTACT
GAGGATGGTGTCACTGAGCCCCAGGCTACCTTCTCTTCTTGCTTCGCTCAGCCCTTCTTGGCTCTTCACCCCATG
CGCTACGCTCACATGTTGGCCGAGAAGATTAAGCAGCACAAGGTTAACGCCTGGCTCCTGAACACCGGTTGGGTT
GGCGCTGGCGCCACCACTGGCGGCAAGCGTTGCCCTCTCAAGTACACTCGTGCCATTCTGGATTCCATCCACAGC
GGCGAGCTGGCCAAGGCTGAGTACGAGAACTACGCTACCTTCAACCTGCCCGTGCCTACTTCCTGCGCCGGTGTC
CCCAGCGAGCTCCTTAACCCTGAGAAGAGCTGGACCGCCTCCACTTCCTTCAAGGATGAGGTCACCAAACTTGCT
GTCCTCTTCAACGAGAACTTCCAGAAGTACTCTGATGAGGCCACCCCCGATGTCCTCGCCGCCGCCCCTCAAGTT
TAG
Gene >Pro_DTO377G3_2|g6706.t1
ATGGTTGCCACATCTGTGAATCGCACTGCCTTGCACCCCGGCGGTGTTCAGTATGTTACCTTCCTATCTCACTGT
CCATACCTCATCGTCGCTAACTGTCTTCACTTAGGCCTAGCAAGGGTCACACCGAGCTTGAGGAGGAGCTTCACG
AGACTGCTCACATTGACTACGACCGTGTCTCCATTGTAAGACCTCACCACCCTTGCGCTAGACATTTGATTACAA
TGTCCATGTCGTCCATCTTGCTTCATCTACTAACATCATTTAGATTGCTAACCCCTCTGTTCCTGCCCTTTACGA
AGATGCTCTTGTCTACGAGACTGGTACTGCTGTTACCTCCAGCGGTGCTTTGAGCGCATACTCCGGTGCTAAGAC
TGGTCGTTCCCCCTCCGACAAGCGTGTCGTCCAGGAGGCTTCCTCAGAAAGCGATATCTGGTGGGGACCCGTAAA
TAAGCCCATGACACTGGATGTGAGTAAACTTTTTGATTCTTGATGCGTGATCACACTCGATATGTCATTGTCCTC
ATTGGAGCACACCCTTGCAGATGGGCCCGAGGAGATCCACTTGGATCCCTTGCATATGCATCGGGAGGTCAAGCT
TTTCGGCAAGACTTTGTGCAACCTTTTGGGTTGCGGTCTCTGCCGGATAATCCCTCATTGCCTTTCCATCATCAT
CCCAGGGAATATTTCCTTCCCCCAGTTTCATTGCCCATTACTTGCCCCCCCCGATTTGCCCCTCGGCTTTCATTT
GCGGCTCCGCAATCCCCGCCCTTGGCCCGATGACATCACGTGAATGACGTCAACAATAAGAATGGTGACTAATAG
ATTCCCCACAGGTCTGGCGTATCAACCGTGAGCGTGCTGTCGACTACCTGAACACCCGTAACCGCATCTATGTTA
TCGATGGTTACGCCGGCTGGGACAAACGCTACCAGATCAGCGTTCGCGTTGTCTGCGCTCGCGCCTACCACGCTC
TCTTCATGCGCAACATGCTGATTCGCCCCAGCCGCGAGGAGCTCGAGCACTTCCACCCCGACTATGTTATCTACA
ATGCTGGCTCTTTCCCTGCCAACCGCTTCACTGAGGGTATGACCTCTGCCACATCCGTGGCCATCAACTTTGCCG
ATAAGGAGATGGTTATCCTTGGTACCGAGTACGCTGGTGAGATGAAGAAGGGTGTCTTCACCGTTCTCTACTACG
AGATGCCCGTCAAGCACAACGTCCTTACTCTTCACTCCTCTGCCAACCAGGGTCCGGATGGTGATGTTACCGTCT
TCTTCGGTCTGTCTGGTACTGGCAAGACCACCTTGTCCGCTGATACTAAGCGCCAGCTGATCGGTGACGACGAGC
ACTGCTGGACTGACACCGGTGTCTTCAACATTGAGGGTGGTTGCTACGCCAAGTGCATTGGTCTCTCCGCCGAGA
AGGAGCCCGATATTTTCAACGCCATCCGCTTCGGCTCCGTTCTTGAGAACACCGTTTTCGACCCCGTCTCCCGCG
TTGTTGACTACGATGATGCCACCCTTACCGAGAACACCCGTTGCGCCTACCCTATTGAGTACATCGACAACGCCA
AGATTCCCTGTGTCAGCGACAACCACCCCAGCAACATCATTCTGCTCACCTGTGATGCCCGCGGTGTCCTGCCTC
CCATTTCCAAGCTCACCCCGGAGCAGACCATGTTCCACTTCATCTCCGGTTACACCTCCAAGATGGCTGGTACTG
AGGATGGTGTCACTGAGCCCCAGGCTACCTTCTCTTCTTGCTTCGCTCAGCCCTTCTTGGCTCTTCACCCCATGC
GCTACGCTCACATGTTGGCCGAGAAGATTAAGCAGCACAAGGTTAACGCCTGGCTCCTGAACACCGGTTGGGTTG
GCGCTGGCGCCACCACTGGCGGCAAGCGTTGCCCTCTCAAGTACACTCGTGCCATTCTGGATTCCATCCACAGCG
GCGAGCTGGCCAAGGCTGAGTACGAGAACTACGCTACCTTCAACCTGCCCGTGCCTACTTCCTGCGCCGGTGTCC
CCAGCGAGCTCCTTAACCCTGAGAAGAGCTGGACCGCCTCCACTTCCTTCAAGGATGAGGTCACCAAACTTGCTG
TCCTCTTCAACGAGAACTTCCAGAAGTACTCTGATGAGGCCACCCCCGATGTCCTCGCCGCCGCCCCTCAAGTTT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail