Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6667.t1
Gene name
Locationscaffold_18:176079..177615
Strand+
Gene length (bp)1536
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain 7.6E-85 189 508
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 6.0E-36 6 179

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0004616 phosphogluconate dehydrogenase (decarboxylating) activity Yes
GO:0006098 pentose-phosphate shunt Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0006739 NADP metabolic process No
GO:0008150 biological_process No
GO:0051156 glucose 6-phosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0019637 organophosphate metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006091 generation of precursor metabolites and energy No
GO:0006740 NADPH regeneration No
GO:1901363 heterocyclic compound binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6667.t1
MSTIKSIGVVGAGNMGSMMTLRFAELGLQVSVWDVIKKNVDEVVRYAKEDKAITGRVQGFYDINQFSKSLEGKSD
HKLFMFSITHGDPADEVLRLLKPDLKEGDIILDGGNENYRNTERRQKECADIGVAWIGMGVSGGYQSARRGPSLS
PGGDAKAIERVMPFLESYAAHDPKTGTACVKRMGPGGSGHYIKMVHNGIEGGMLSVLAETWQYMHEGLGMEHGTI
GDVFDKWNETGELRGNFLINIGAKILHTRRTPKGDYKGEGASRDDGYVLDDVLDKVVQDDDGTEGTPHWCVMESA
ARHVSCPTLAAAQYLRISSGNRVERARVAKKLEMPMPKPIEGTRDHNVIIENLRQAVYCSFLASFCQGLELISRA
SIDEGWKVNLGDCLQIWRAGCIIKSDYIADLLQPPLAAQNELTNAKFVDTVAHELHQNFHSLKQVVMEGTMFDQY
IPALSATLEYLKYEGGLGLPTQFMEAQMDYFGAHSYNKPGIPGEDPGPVHKGPHHYEWLPA*
Coding >Pro_DTO377G3_2|g6667.t1
ATGTCCACCATCAAAAGCATCGGCGTCGTCGGAGCTGGAAACATGGGCTCTATGATGACCCTTCGCTTCGCTGAG
CTCGGGCTCCAAGTCTCTGTCTGGGATGTAATAAAGAAGAACGTCGACGAAGTGGTGCGCTACGCCAAAGAGGAC
AAAGCTATAACAGGCCGAGTTCAAGGCTTCTATGACATCAACCAATTCTCCAAGAGCCTAGAGGGCAAGTCCGAC
CACAAACTATTCATGTTTTCTATCACGCACGGTGACCCCGCGGATGAAGTACTTCGCTTGTTGAAACCAGACCTG
AAAGAGGGTGATATCATCCTGGACGGTGGAAATGAGAACTACCGGAATACCGAGCGGCGCCAGAAAGAGTGTGCT
GACATCGGTGTCGCCTGGATTGGAATGGGCGTCTCGGGTGGATATCAATCTGCACGACGAGGACCCAGTCTCTCG
CCAGGTGGAGATGCCAAAGCCATCGAGCGTGTTATGCCGTTCTTGGAGTCGTATGCGGCCCATGATCCCAAAACT
GGGACTGCCTGCGTGAAGCGCATGGGTCCCGGTGGATCAGGACACTACATCAAGATGGTTCATAATGGCATCGAG
GGTGGAATGCTTTCTGTACTTGCTGAAACATGGCAATACATGCACGAGGGACTCGGCATGGAGCATGGCACAATC
GGAGATGTCTTCGATAAATGGAATGAGACTGGCGAGCTGCGGGGCAACTTCCTGATTAACATCGGCGCCAAGATT
TTACACACACGGAGAACCCCCAAAGGAGACTACAAAGGCGAGGGAGCCAGTCGGGATGATGGATATGTGCTCGAT
GATGTCCTCGACAAGGTGGTTCAGGACGACGATGGTACTGAAGGTACTCCACACTGGTGTGTTATGGAGTCTGCC
GCCCGGCATGTCTCTTGTCCGACGTTAGCGGCTGCCCAGTACCTGCGAATCTCAAGTGGAAATCGCGTGGAGCGA
GCGCGTGTTGCGAAGAAGCTGGAGATGCCCATGCCGAAACCGATAGAGGGAACCCGGGACCACAATGTGATTATC
GAGAACCTACGACAAGCTGTGTACTGCTCGTTCCTGGCATCTTTCTGTCAGGGGCTGGAGCTGATTTCCCGGGCC
TCGATAGACGAAGGCTGGAAGGTCAATTTGGGCGACTGTCTGCAGATCTGGCGAGCGGGATGTATCATCAAGTCT
GATTACATTGCGGATCTACTGCAGCCGCCGCTTGCAGCCCAAAATGAGCTGACAAACGCCAAGTTTGTGGATACT
GTTGCACATGAGTTGCACCAGAACTTCCATAGTCTCAAGCAAGTTGTCATGGAGGGAACCATGTTTGATCAATAT
ATTCCGGCTCTCTCAGCTACTCTGGAATATCTCAAGTATGAGGGTGGATTGGGACTGCCGACCCAGTTCATGGAG
GCGCAGATGGACTACTTCGGTGCACACAGCTACAACAAGCCTGGTATTCCCGGTGAGGATCCTGGACCGGTTCAC
AAGGGCCCTCACCACTACGAGTGGCTGCCGGCTTAA
Transcript >Pro_DTO377G3_2|g6667.t1
ATGTCCACCATCAAAAGCATCGGCGTCGTCGGAGCTGGAAACATGGGCTCTATGATGACCCTTCGCTTCGCTGAG
CTCGGGCTCCAAGTCTCTGTCTGGGATGTAATAAAGAAGAACGTCGACGAAGTGGTGCGCTACGCCAAAGAGGAC
AAAGCTATAACAGGCCGAGTTCAAGGCTTCTATGACATCAACCAATTCTCCAAGAGCCTAGAGGGCAAGTCCGAC
CACAAACTATTCATGTTTTCTATCACGCACGGTGACCCCGCGGATGAAGTACTTCGCTTGTTGAAACCAGACCTG
AAAGAGGGTGATATCATCCTGGACGGTGGAAATGAGAACTACCGGAATACCGAGCGGCGCCAGAAAGAGTGTGCT
GACATCGGTGTCGCCTGGATTGGAATGGGCGTCTCGGGTGGATATCAATCTGCACGACGAGGACCCAGTCTCTCG
CCAGGTGGAGATGCCAAAGCCATCGAGCGTGTTATGCCGTTCTTGGAGTCGTATGCGGCCCATGATCCCAAAACT
GGGACTGCCTGCGTGAAGCGCATGGGTCCCGGTGGATCAGGACACTACATCAAGATGGTTCATAATGGCATCGAG
GGTGGAATGCTTTCTGTACTTGCTGAAACATGGCAATACATGCACGAGGGACTCGGCATGGAGCATGGCACAATC
GGAGATGTCTTCGATAAATGGAATGAGACTGGCGAGCTGCGGGGCAACTTCCTGATTAACATCGGCGCCAAGATT
TTACACACACGGAGAACCCCCAAAGGAGACTACAAAGGCGAGGGAGCCAGTCGGGATGATGGATATGTGCTCGAT
GATGTCCTCGACAAGGTGGTTCAGGACGACGATGGTACTGAAGGTACTCCACACTGGTGTGTTATGGAGTCTGCC
GCCCGGCATGTCTCTTGTCCGACGTTAGCGGCTGCCCAGTACCTGCGAATCTCAAGTGGAAATCGCGTGGAGCGA
GCGCGTGTTGCGAAGAAGCTGGAGATGCCCATGCCGAAACCGATAGAGGGAACCCGGGACCACAATGTGATTATC
GAGAACCTACGACAAGCTGTGTACTGCTCGTTCCTGGCATCTTTCTGTCAGGGGCTGGAGCTGATTTCCCGGGCC
TCGATAGACGAAGGCTGGAAGGTCAATTTGGGCGACTGTCTGCAGATCTGGCGAGCGGGATGTATCATCAAGTCT
GATTACATTGCGGATCTACTGCAGCCGCCGCTTGCAGCCCAAAATGAGCTGACAAACGCCAAGTTTGTGGATACT
GTTGCACATGAGTTGCACCAGAACTTCCATAGTCTCAAGCAAGTTGTCATGGAGGGAACCATGTTTGATCAATAT
ATTCCGGCTCTCTCAGCTACTCTGGAATATCTCAAGTATGAGGGTGGATTGGGACTGCCGACCCAGTTCATGGAG
GCGCAGATGGACTACTTCGGTGCACACAGCTACAACAAGCCTGGTATTCCCGGTGAGGATCCTGGACCGGTTCAC
AAGGGCCCTCACCACTACGAGTGGCTGCCGGCTTAA
Gene >Pro_DTO377G3_2|g6667.t1
ATGTCCACCATCAAAAGCATCGGCGTCGTCGGAGCTGGAAACATGGGCTCTATGATGACCCTTCGCTTCGCTGAG
CTCGGGCTCCAAGTCTCTGTCTGGGATGTAATAAAGAAGAACGTCGACGAAGTGGTGCGCTACGCCAAAGAGGAC
AAAGCTATAACAGGCCGAGTTCAAGGCTTCTATGACATCAACCAATTCTCCAAGAGCCTAGAGGGCAAGTCCGAC
CACAAACTATTCATGTTTTCTATCACGCACGGTGACCCCGCGGATGAAGTACTTCGCTTGTTGAAACCAGACCTG
AAAGAGGGTGATATCATCCTGGACGGTGGAAATGAGAACTACCGGAATACCGAGCGGCGCCAGAAAGAGTGTGCT
GACATCGGTGTCGCCTGGATTGGAATGGGCGTCTCGGGTGGATATCAATCTGCACGACGAGGACCCAGTCTCTCG
CCAGGTGGAGATGCCAAAGCCATCGAGCGTGTTATGCCGTTCTTGGAGTCGTATGCGGCCCATGATCCCAAAACT
GGGACTGCCTGCGTGAAGCGCATGGGTCCCGGTGGATCAGGACACTACATCAAGATGGTTCATAATGGCATCGAG
GGTGGAATGCTTTCTGTACTTGCTGAAACATGGCAATACATGCACGAGGGACTCGGCATGGAGCATGGCACAATC
GGAGATGTCTTCGATAAATGGAATGAGACTGGCGAGCTGCGGGGCAACTTCCTGATTAACATCGGCGCCAAGATT
TTACACACACGGAGAACCCCCAAAGGAGACTACAAAGGCGAGGGAGCCAGTCGGGATGATGGATATGTGCTCGAT
GATGTCCTCGACAAGGTGGTTCAGGACGACGATGGTACTGAAGGTACTCCACACTGGTGTGTTATGGAGTCTGCC
GCCCGGCATGTCTCTTGTCCGACGTTAGCGGCTGCCCAGTACCTGCGAATCTCAAGTGGAAATCGCGTGGAGCGA
GCGCGTGTTGCGAAGAAGCTGGAGATGCCCATGCCGAAACCGATAGAGGGAACCCGGGACCACAATGTGATTATC
GAGAACCTACGACAAGCTGTGTACTGCTCGTTCCTGGCATCTTTCTGTCAGGGGCTGGAGCTGATTTCCCGGGCC
TCGATAGACGAAGGCTGGAAGGTCAATTTGGGCGACTGTCTGCAGATCTGGCGAGCGGGATGTATCATCAAGTCT
GATTACATTGCGGATCTACTGCAGCCGCCGCTTGCAGCCCAAAATGAGCTGACAAACGCCAAGTTTGTGGATACT
GTTGCACATGAGTTGCACCAGAACTTCCATAGTCTCAAGCAAGTTGTCATGGAGGGAACCATGTTTGATCAATAT
ATTCCGGCTCTCTCAGCTACTCTGGAATATCTCAAGTATGAGGGTGGATTGGGACTGCCGACCCAGTTCATGGAG
GCGCAGATGGACTACTTCGGTGCACACAGCTACAACAAGCCTGGTATTCCCGGTGAGGATCCTGGACCGGTTCAC
AAGGGCCCTCACCACTACGAGTGGCTGCCGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail