Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6664.t1
Gene name
Locationscaffold_18:169807..171744
Strand+
Gene length (bp)1937
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 2.5E-127 42 508
PF13520 AA_permease_2 Amino acid permease 2.3E-28 44 493

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 77 99 22
3 120 142 22
4 152 174 22
5 181 203 22
6 235 257 22
7 277 299 22
8 319 341 22
9 379 396 17
10 406 428 22
11 453 475 22
12 479 501 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6664.t1
MKDSPKSLEAAVRPESPYDDPKDMQGEIIHNSDTKRGLSSRHIQFLALGGCIGTGLFVGSGSALATVGPAPLLMG
YIVMSSIVYFIMNMLGEMTTYLPVQGVSVPYLITRFTEPSLGFAVGYNYWYSFSMLIASEVTASGMVIEYWQSPV
SVGVWIAIILVVILLLNIVAVAWYGEAEFWFASLKIIAIVGLIILGIVLFFGGGPNHDRLGFRYWQRPGAFVEPY
LVPNINTGRFLAFWTAMIKCGFSFIFSPELITTAAGEAASPRRNIPKAAKRFIYRLFAFYILGALVIGVIVAYND
KNLLQGVASGSSGAGASPFVIGIQNAGITGLNHVINAVVLISAFSSGNSWVFAGSRTLYSLAGEGQAPKIFLRCN
KNGVPYNAVIVTWMIGLLSFLNLSTSGSTVFYWFTNITTIGGFISWVIVAVAYLRWRSALDFHGLLPSRPFITPI
QPYGAYYVIGFISLLAITNGYTVFFPGSFTASDFLVSYIVFAIFFVLYFGHKIYYKTPWMTKVSELDIFTGKDEI
DRLEEEEVEPQPRNWLERVWWWIA*
Coding >Pro_DTO377G3_2|g6664.t1
ATGAAAGACTCACCTAAGAGTCTCGAGGCGGCGGTCCGTCCTGAGTCCCCATATGACGACCCAAAAGACATGCAG
GGGGAGATCATTCACAACTCAGATACTAAGCGAGGCTTGAGCTCGCGCCATATTCAATTCTTGGCTCTAGGTGGT
TGTATAGGCACGGGTCTTTTTGTTGGCAGTGGCTCAGCGCTGGCGACAGTTGGTCCTGCTCCGTTGCTCATGGGT
TATATTGTCATGTCAAGTATTGTATACTTTATCATGAACATGCTTGGAGAAATGACCACCTATCTTCCCGTTCAA
GGTGTTTCTGTGCCATATTTGATTACTCGGTTTACGGAACCTAGTCTTGGATTTGCTGTTGGATACAACTACTGG
TATTCATTTTCAATGTTGATAGCATCAGAGGTCACTGCGTCAGGGATGGTCATTGAATATTGGCAGTCCCCAGTC
AGCGTTGGTGTATGGATTGCGATCATTCTCGTTGTCATTCTACTTCTAAACATTGTCGCGGTGGCCTGGTATGGC
GAAGCCGAATTCTGGTTCGCATCACTCAAGATCATCGCGATCGTCGGTCTGATCATCCTGGGTATTGTACTTTTC
TTCGGCGGTGGTCCAAACCATGATCGTCTCGGTTTCCGGTACTGGCAACGACCAGGCGCATTTGTGGAACCTTAC
TTAGTCCCAAACATCAACACAGGCCGCTTTCTAGCATTCTGGACCGCTATGATCAAGTGCGGATTCTCTTTCATT
TTCTCCCCGGAACTGATCACCACTGCTGCCGGCGAGGCTGCCTCGCCACGCCGCAACATCCCCAAGGCGGCAAAG
CGGTTTATCTACCGTTTATTTGCATTTTATATCTTGGGCGCATTGGTCATTGGTGTGATAGTCGCATACAATGAC
AAGAACCTCCTGCAGGGTGTTGCGAGCGGCAGTTCTGGTGCTGGCGCCAGTCCATTCGTTATTGGCATCCAGAAT
GCTGGTATCACTGGATTGAACCACGTTATCAATGCTGTTGTTCTTATCTCTGCCTTTTCCTCGGGTAATTCTTGG
GTCTTTGCTGGGTCTCGCACACTTTACTCGCTCGCGGGTGAGGGCCAGGCTCCCAAAATCTTCCTTCGCTGCAAC
AAGAATGGTGTCCCGTACAATGCTGTGATAGTCACTTGGATGATCGGTCTGCTGTCTTTCTTGAACCTATCTACT
TCGGGTTCAACCGTCTTTTATTGGTTTACCAACATCACGACAATTGGAGGTTTCATCTCTTGGGTCATCGTGGCA
GTGGCGTACTTGCGTTGGCGCAGCGCATTGGACTTCCACGGGCTGCTCCCGTCCAGGCCCTTCATTACCCCCATC
CAGCCATACGGCGCTTACTATGTTATTGGCTTTATTTCACTCCTGGCTATTACCAATGGCTATACGGTATTCTTC
CCAGGCTCTTTCACTGCGTCGGACTTCCTTGTTTCCTACATTGTCTTCGCGATTTTCTTCGTGCTGTACTTTGGC
CACAAAATATACTACAAGACGCCATGGATGACCAAGGTATCAGAACTTGACATTTTCACTGGCAAGGATGAGATC
GACCGACTTGAAGAGGAGGAGGTAGAGCCGCAGCCACGCAACTGGCTAGAGCGAGTGTGGTGGTGGATTGCATAG
Transcript >Pro_DTO377G3_2|g6664.t1
ATGAAAGACTCACCTAAGAGTCTCGAGGCGGCGGTCCGTCCTGAGTCCCCATATGACGACCCAAAAGACATGCAG
GGGGAGATCATTCACAACTCAGATACTAAGCGAGGCTTGAGCTCGCGCCATATTCAATTCTTGGCTCTAGGTGGT
TGTATAGGCACGGGTCTTTTTGTTGGCAGTGGCTCAGCGCTGGCGACAGTTGGTCCTGCTCCGTTGCTCATGGGT
TATATTGTCATGTCAAGTATTGTATACTTTATCATGAACATGCTTGGAGAAATGACCACCTATCTTCCCGTTCAA
GGTGTTTCTGTGCCATATTTGATTACTCGGTTTACGGAACCTAGTCTTGGATTTGCTGTTGGATACAACTACTGG
TATTCATTTTCAATGTTGATAGCATCAGAGGTCACTGCGTCAGGGATGGTCATTGAATATTGGCAGTCCCCAGTC
AGCGTTGGTGTATGGATTGCGATCATTCTCGTTGTCATTCTACTTCTAAACATTGTCGCGGTGGCCTGGTATGGC
GAAGCCGAATTCTGGTTCGCATCACTCAAGATCATCGCGATCGTCGGTCTGATCATCCTGGGTATTGTACTTTTC
TTCGGCGGTGGTCCAAACCATGATCGTCTCGGTTTCCGGTACTGGCAACGACCAGGCGCATTTGTGGAACCTTAC
TTAGTCCCAAACATCAACACAGGCCGCTTTCTAGCATTCTGGACCGCTATGATCAAGTGCGGATTCTCTTTCATT
TTCTCCCCGGAACTGATCACCACTGCTGCCGGCGAGGCTGCCTCGCCACGCCGCAACATCCCCAAGGCGGCAAAG
CGGTTTATCTACCGTTTATTTGCATTTTATATCTTGGGCGCATTGGTCATTGGTGTGATAGTCGCATACAATGAC
AAGAACCTCCTGCAGGGTGTTGCGAGCGGCAGTTCTGGTGCTGGCGCCAGTCCATTCGTTATTGGCATCCAGAAT
GCTGGTATCACTGGATTGAACCACGTTATCAATGCTGTTGTTCTTATCTCTGCCTTTTCCTCGGGTAATTCTTGG
GTCTTTGCTGGGTCTCGCACACTTTACTCGCTCGCGGGTGAGGGCCAGGCTCCCAAAATCTTCCTTCGCTGCAAC
AAGAATGGTGTCCCGTACAATGCTGTGATAGTCACTTGGATGATCGGTCTGCTGTCTTTCTTGAACCTATCTACT
TCGGGTTCAACCGTCTTTTATTGGTTTACCAACATCACGACAATTGGAGGTTTCATCTCTTGGGTCATCGTGGCA
GTGGCGTACTTGCGTTGGCGCAGCGCATTGGACTTCCACGGGCTGCTCCCGTCCAGGCCCTTCATTACCCCCATC
CAGCCATACGGCGCTTACTATGTTATTGGCTTTATTTCACTCCTGGCTATTACCAATGGCTATACGGTATTCTTC
CCAGGCTCTTTCACTGCGTCGGACTTCCTTGTTTCCTACATTGTCTTCGCGATTTTCTTCGTGCTGTACTTTGGC
CACAAAATATACTACAAGACGCCATGGATGACCAAGGTATCAGAACTTGACATTTTCACTGGCAAGGATGAGATC
GACCGACTTGAAGAGGAGGAGGTAGAGCCGCAGCCACGCAACTGGCTAGAGCGAGTGTGGTGGTGGATTGCATAG
Gene >Pro_DTO377G3_2|g6664.t1
ATGAAAGACTCACCTAAGAGTCTCGAGGCGGCGGTCCGTCCTGAGTCCCCATATGACGACCCAAAAGACATGCAG
GGGGAGATCATTCACAACTCAGATACTAAGCGAGGCTTGAGCTCGCGCCATATTCAATTCTTGGCTCTAGGTGGT
TGTATAGGCACGGGTCTTTTTGTTGGCAGTGGCTCAGCGCTGGCGACAGTTGGTCCTGGTAAGAATCAGCGTGTG
AAACATAAACTTGATATGGGGCTAATATGTGATAGCTCCGTTGCTCATGGGTTATATTGTCATGTCAAGTATTGT
ATACTTTATCATGAACATGCTTGGAGAAATGACCACCTATCTTCCCGTTCAAGGTGTTTCTGTGCCATATTTGAT
TACTCGGTTTACGGAACCTAGTCTTGGATTTGCTGTTGGTATGTGAAGACACTTTGAAAATTTTTAACAAGCCCA
ATGCTGATTCAAATACTACTAGGATACAACTACTGGTAATAACCCTTCGGTCAAGGTCCGAGTTTGTCATACTAA
TAAATGCCCTGTGTAGGTATTCATTTTCAATGTTGATAGCATCAGAGGTCACTGCGTCAGGGATGGTCATTGAAT
ATTGGCAGTCCCCAGTCAGCGTTGGTGTATGGATTGCGATCATTCTCGTTGGTGGGTACATGCCCAACAGTGCGG
TATACCTGATATCCTCTAACGCATGAACTCTAGTCATTCTACTTCTAAACATTGTCGCGGTGGCCTGGTATGGCG
AAGCCGAATTCTGGTTCGCATCACTCAAGATCATCGCGATCGTCGGTCTGATCATCCTGGGTATTGTACTTTTCT
TCGGCGGTGGTCCAAACCATGATCGTCTCGGTTTCCGGTACTGGCAACGACCAGGCGCATTTGTGGAACCTTACT
TAGTCCCAAACATCAACACAGGCCGCTTTCTAGCATTCTGGACCGCTATGATCAAGTGCGGATTCTCTTTCATTT
TCTCCCCGGAACTGATCACCACTGCTGCCGGCGAGGCTGCCTCGCCACGCCGCAACATCCCCAAGGCGGCAAAGC
GGTTTATCTACCGTTTATTTGCATTTTATATCTTGGGCGCATTGGTCATTGGTGTGATAGTCGCATACAATGACA
AGAACCTCCTGCAGGGTGTTGCGAGCGGCAGTTCTGGTGCTGGCGCCAGTCCATTCGTTATTGGCATCCAGAATG
CTGGTATCACTGGATTGAACCACGTTATCAATGCTGTTGTTCTTATCTCTGCCTTTTCCTCGGGTAATTCTTGGG
TCTTTGCTGGGTCTCGCACACTTTACTCGCTCGCGGGTGAGGGCCAGGCTCCCAAAATCTTCCTTCGCTGCAACA
AGAATGGTGTCCCGTACAATGCTGTGATAGTCACTTGGATGATCGGTCTGCTGTCTTTCTTGAACCTATCTACTT
CGGGTTCAACCGTCTTTTATTGGTTTACCAACATCACGACAATTGGAGGTTTCATCTCTTGGGTCATCGTGGCAG
TGGCGTACTTGGTAAGTTAAATAGCCTTTTTTCCTGTCTTTTTCATGGAATAACTTGCTAACAAATTATTTTAGC
GTTGGCGCAGCGCATTGGACTTCCACGGGCTGCTCCCGTCCAGGCCCTTCATTACCCCCATCCAGCCATACGGCG
CTTACTATGTTATTGGCTTTATTTCACTCCTGGCTATTACCAATGGCTATACGGTATTCTTCCCAGGCTCTTTCA
CTGCGTCGGACTTCCTTGTTTCCTACATTGTCTTCGCGATTTTCTTCGTGCTGTACTTTGGCCACAAAATATACT
ACAAGACGCCATGGATGACCAAGGTATCAGAACTTGACATTTTCACTGGCAAGGATGAGATCGACCGACTTGAAG
AGGAGGAGGTAGAGCCGCAGCCACGCAACTGGCTAGAGCGAGTGTGGTGGTGGATTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail