Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g665.t1
Gene name
Locationscaffold_01:1715611..1716224
Strand+
Gene length (bp)613
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11578 DUF3237 Protein of unknown function (DUF3237) 1.7E-31 12 171

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.63 0.55 8.70
5d_25C Five days - 25 degrees Celsius 4.42 0.38 8.46
7d_25C Seven days - 25 degrees Celsius 7.84 1.12 14.56
10d_25C Ten days - 25 degrees Celsius 4.70 0.42 8.99
7d_15C Seven days - 15 degrees Celsius 13.47 1.21 25.73
7d_30C Seven days - 30 degrees Celsius 8.43 1.76 15.11

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.953921 no
3d_25C 7d_25C 0.322073 no
3d_25C 7d_15C 0.028409 yes
3d_25C 7d_30C 0.225672 no
3d_25C 10d_25C 0.982118 no
5d_25C 7d_25C 0.272632 no
5d_25C 7d_15C 0.022940 yes
5d_25C 7d_30C 0.183143 no
5d_25C 10d_25C 0.936012 no
7d_25C 7d_15C 0.313253 no
7d_25C 7d_30C 0.917212 no
7d_25C 10d_25C 0.329336 no
7d_15C 7d_30C 0.382028 no
7d_15C 10d_25C 0.026832 yes
7d_30C 10d_25C 0.233813 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g665.t1
MEPQTKDPDPLPRLVHIGEIQFNLGEVTTGGVTPRGTFIFCPITGGHFTTVFPLPDGFGIHSEAIEGLRAEVLPG
GGDYPLIHNNELAELNVSVVAKGLNNDHIFRITSFGICEWNKLIFDMMGQTAAARSTEMGEINAWQVFRINTDSP
EYAWLNWACIIGQERLIYEDSRMAKTHMKLFQFLVK*
Coding >Pro_DTO377G3_2|g665.t1
ATGGAACCTCAAACGAAAGACCCCGACCCCCTACCGCGTCTGGTGCACATAGGCGAAATACAGTTCAACCTGGGC
GAAGTGACCACGGGCGGAGTGACGCCGCGAGGAACTTTCATTTTCTGCCCCATAACTGGCGGACACTTTACCACC
GTCTTTCCATTACCGGACGGATTCGGCATTCACTCAGAGGCAATCGAAGGTCTGAGGGCAGAGGTGCTTCCAGGT
GGCGGCGATTATCCGCTGATACATAACAATGAACTTGCGGAACTGAATGTCAGCGTCGTCGCCAAAGGTCTCAAC
AACGATCATATATTCCGTATCACCTCTTTCGGTATATGCGAATGGAACAAACTCATATTCGATATGATGGGCCAG
ACAGCCGCCGCACGCTCGACGGAGATGGGGGAAATCAACGCATGGCAGGTTTTTCGTATCAACACTGATAGCCCG
GAGTATGCCTGGCTAAACTGGGCATGCATCATTGGGCAGGAGAGACTGATTTACGAAGACAGTCGCATGGCTAAG
ACTCACATGAAATTGTTCCAGTTTCTGGTAAAATAG
Transcript >Pro_DTO377G3_2|g665.t1
ATGGAACCTCAAACGAAAGACCCCGACCCCCTACCGCGTCTGGTGCACATAGGCGAAATACAGTTCAACCTGGGC
GAAGTGACCACGGGCGGAGTGACGCCGCGAGGAACTTTCATTTTCTGCCCCATAACTGGCGGACACTTTACCACC
GTCTTTCCATTACCGGACGGATTCGGCATTCACTCAGAGGCAATCGAAGGTCTGAGGGCAGAGGTGCTTCCAGGT
GGCGGCGATTATCCGCTGATACATAACAATGAACTTGCGGAACTGAATGTCAGCGTCGTCGCCAAAGGTCTCAAC
AACGATCATATATTCCGTATCACCTCTTTCGGTATATGCGAATGGAACAAACTCATATTCGATATGATGGGCCAG
ACAGCCGCCGCACGCTCGACGGAGATGGGGGAAATCAACGCATGGCAGGTTTTTCGTATCAACACTGATAGCCCG
GAGTATGCCTGGCTAAACTGGGCATGCATCATTGGGCAGGAGAGACTGATTTACGAAGACAGTCGCATGGCTAAG
ACTCACATGAAATTGTTCCAGTTTCTGGTAAAATAG
Gene >Pro_DTO377G3_2|g665.t1
ATGGAACCTCAAACGAAAGACCCCGACCCCCTACCGCGTCTGGTGCACATAGGCGAAATACAGTTCAACCTGGGC
GAAGTGACCACGGGCGGAGTGACGCCGCGAGGAACTTTCATTTTCTGCCCCATAACTGGCGGTGAGTTGAAATAT
AGAAACACACATTGGACCTGGGGCTGACCCAAAGGCAGGACACTTTACCACCGTCTTTCCATTACCGGACGGATT
CGGCATTCACTCAGAGGCAATCGAAGGTCTGAGGGCAGAGGTGCTTCCAGGTGGCGGCGATTATCCGCTGATACA
TAACAATGAACTTGCGGAACTGAATGTCAGCGTCGTCGCCAAAGGTCTCAACAACGATCATATATTCCGTATCAC
CTCTTTCGGTATATGCGAATGGAACAAACTCATATTCGATATGATGGGCCAGACAGCCGCCGCACGCTCGACGGA
GATGGGGGAAATCAACGCATGGCAGGTTTTTCGTATCAACACTGATAGCCCGGAGTATGCCTGGCTAAACTGGGC
ATGCATCATTGGGCAGGAGAGACTGATTTACGAAGACAGTCGCATGGCTAAGACTCACATGAAATTGTTCCAGTT
TCTGGTAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail