Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6644.t1
Gene name
Locationscaffold_18:120113..125679
Strand-
Gene length (bp)5566
Transcript length (bp)5373
Coding sequence length (bp)5373
Protein length (aa) 1791

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00632 HECT HECT-domain (ubiquitin-transferase) 9.5E-75 1442 1790

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0019787 ubiquitin-like protein transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6644.t1
MSSRITRSSARLATDPPPAESGTPLQTPGSTSSRKRKASSRHDRQADAPIQPAPASPQRKTKRPRTAASQTAPST
GPVPAAPRRGARSRTAMSQPGPSSRPSEESSKSTTSPQPSRRKSSRNDRPATTQSPPPRRPKKRSGKSNPDVLMR
DAEEEIEEEEHQEEQQGSQTGESNDGTNPSAFGDDDMDPFHSSLFGGRGPMGLQSTLRALTGMMSGMSSRLRDIL
TNLRAKDDPSLQLIALQELSDLLLVSNEDNLSGQFSPDPYVKELVTLMQPNQFGEENPEIMLLACRSLANLMEAL
RGSVANVVYGGAVPILCQKLLDIQFIDLAEQALSTLAKISVDFPASIVREGGLTACLTYLDFFPTSTQRTAVSTA
ANCCRNLPHDSFPVVRDVMPTLLNVLSSNDPKVVEQGCLCVSRIVESFKHRPENLEELIEPAMLKAILRLLLPGT
TNLIGPHIHTQFLRVLAIVSRTSPRLSNELLKMDVVDTLYQILTGVSPPQDVDNTAVKMDSVLVMQALIHRPREQ
VYETLNVVCELLPGVPSRDASKTDNLLSSYFDSHMSIGLRSPKSKETVEERRSLLVNCKTELKRFAMILFPTLTD
AYSSTVNLHVRQKVLIAQLKMLHILEPSLIEDALRTVPYASFLAAILSQKDHPSLVSLALRCAELLFQRLEHVYQ
HQFHREGVISAIIKLSEGSLSGDQENIDSSDPSRINTSTDSSRGANQIVGETGSGGDDEDEDDEPDDFDDDDGED
DDQDDMSDSEDDFMAGPRSRQKMDNALNDVVIQDAQAFLEVYEASHGETVRAEALRILTALKSLASEIKSRYSRG
GEGGLPLFKQLASYFDGDALEGITSSELLNSGIIDVLLCVLGNFQSPSIRDARADFLRAFMGVSISDKAQSQSTA
TTPFSVLIRKLQDLLSRTEHFEVLTISHNSLENTRSNAAYMLSKQLRLKLVADEGSEVPRPYRNIMVSIHAIATF
KALDDFLHPRIAVAEKPRPSRTRDSILSQIANASRLREQLASGSGMSLPNPTGGLQGTMTDPTDGVYDSSTDHPH
HHQSNRIQEDEDEEDEEPLECADERQLTDEEEGGEEDEGDQLNAIVDDLDEDMENDDISDPSAVNMEVASSGKVT
ARKEDGTRIGTPSQTAASKPSSSAPAALPSHTRNSSLATAGRPFSSYAAAMASVPQDWHLEFFVDGKPVTNETTI
YRGVHHDREDLDESSAKNVWSAVHTITFKRVPGPPPPEPSTLTPTVQASSEGDALEIPASLDKDPTTSSIIRLLR
VLHEMNATIDDILTDTKDSATITSEPLAQFINTKLTAKINRQLEEPLIVASDCLPSWSEDLARLFSFLFPFETRH
LFLQSTAFGYSRAMMRWQNSQSGEDSRRDLRRDDRPFLGRLQRQKVRISRSRILDSALKVMELYGSSPSILEVEY
FEEVGTGLGPTLEFYSTVSREFSKKKLKIWRDTDGSSTTEYAFGKSGLFPAPMSDEQASQDIGKRQLNIFKVLGK
FVARSMLDSRIIDISFNPAFFRIADTLSSVAPSLGTVKLVDHDLAKSLVMLKEFVNAKNVIEANQSLSPALKSEA
VQNITVHGASVDDLGLDFTLPGYPAIELISDGANVPLTIENIDTYIERVIDMTLGSGVRRQVDAFRAGFSQVFPF
SSLCAFTPSELVMLFGQADEDWSIETLMDSIKADHGFNMDSRSVRNLLQTMSELDNQQRRDFLQFVTGSPKLPIG
GFKSLTPIFTVVCRPSEHPYTPDDYLPSVMTCVNYLKLPDYSDLDVLKKRLSVAIKEGQGAFHLS*
Coding >Pro_DTO377G3_2|g6644.t1
ATGTCATCCAGAATAACTCGCTCCTCCGCGAGACTCGCCACAGACCCTCCACCTGCTGAGTCCGGTACACCGCTT
CAAACACCTGGCTCTACCTCATCCCGGAAACGCAAGGCATCCTCCCGCCACGACCGACAAGCAGACGCCCCGATA
CAGCCAGCACCGGCATCGCCCCAAAGGAAAACCAAGCGACCGCGGACTGCAGCATCTCAAACAGCTCCATCTACT
GGTCCTGTTCCTGCTGCACCCCGTCGAGGAGCCCGCAGCCGTACAGCCATGTCACAACCGGGACCTTCATCTCGA
CCGTCGGAGGAATCATCGAAATCGACGACCTCCCCACAACCATCGAGGCGAAAGTCAAGTCGGAACGACCGACCC
GCGACGACACAGTCCCCGCCGCCCCGACGCCCGAAGAAGCGTTCGGGCAAGTCAAATCCCGATGTTTTGATGAGA
GATGCAGAGGAGGAAATCGAGGAGGAAGAGCATCAGGAAGAACAACAAGGATCTCAAACGGGAGAGAGCAACGAT
GGCACCAATCCCTCGGCGTTCGGTGATGATGATATGGATCCGTTCCACAGCAGCCTATTCGGTGGCAGAGGCCCC
ATGGGACTCCAGAGCACTTTACGTGCCCTCACTGGCATGATGAGTGGCATGTCATCACGTCTTCGAGATATTCTC
ACCAACTTGAGAGCGAAGGATGATCCATCTCTCCAATTGATCGCCTTGCAAGAGCTGTCAGATCTCTTGCTTGTA
TCGAACGAGGATAACCTGTCTGGTCAATTTTCGCCGGACCCGTATGTGAAGGAGCTCGTGACTTTGATGCAGCCA
AATCAGTTTGGCGAAGAAAATCCCGAGATTATGCTTCTTGCATGTCGCTCTCTTGCGAATCTAATGGAGGCCCTA
CGGGGCTCCGTAGCTAATGTTGTATATGGTGGTGCTGTACCCATCCTCTGCCAAAAGCTGCTCGATATACAGTTC
ATCGATCTAGCTGAGCAGGCTTTGAGTACATTGGCCAAGATTTCAGTCGACTTCCCAGCCTCAATCGTGCGAGAA
GGTGGATTGACCGCATGCCTCACGTATCTGGATTTCTTCCCAACCAGTACTCAACGAACAGCAGTTAGTACGGCC
GCTAACTGCTGTCGTAACCTCCCTCATGACTCGTTCCCTGTGGTGCGGGATGTAATGCCCACCCTACTCAACGTC
CTCTCTAGCAATGATCCTAAGGTCGTGGAGCAAGGGTGCCTATGCGTATCACGGATTGTCGAGAGCTTCAAGCAC
CGACCGGAGAACCTGGAGGAGCTGATTGAGCCTGCAATGCTCAAAGCTATCCTTCGGCTTCTACTGCCAGGAACA
ACAAACCTGATCGGGCCTCATATCCACACGCAATTCCTTAGGGTATTGGCAATCGTATCGAGAACAAGCCCACGA
TTGTCAAATGAGCTTCTCAAGATGGATGTAGTGGATACGCTTTACCAAATTTTGACCGGCGTGTCACCACCGCAG
GATGTGGATAACACGGCCGTTAAGATGGACAGCGTGCTAGTCATGCAAGCATTGATTCATCGGCCCCGTGAACAA
GTATATGAAACTCTCAATGTCGTCTGCGAGCTATTGCCAGGCGTTCCAAGCCGCGATGCCTCAAAAACCGACAAC
CTCCTAAGCTCATACTTTGATAGCCACATGTCCATTGGACTGAGATCTCCCAAATCTAAAGAGACAGTGGAGGAA
AGGCGGTCCTTGCTCGTTAATTGCAAGACTGAGCTTAAGCGTTTTGCGATGATTCTGTTCCCAACTTTGACCGAT
GCCTACTCGAGCACGGTCAATCTGCATGTCCGCCAGAAGGTCCTGATTGCACAGCTGAAGATGCTGCATATCCTT
GAGCCTTCTTTGATCGAAGACGCCCTGCGCACAGTCCCTTACGCTTCGTTTTTGGCTGCCATTCTGTCCCAAAAA
GACCACCCTTCTCTCGTATCTTTAGCTCTACGCTGCGCTGAGCTACTGTTCCAGCGGCTTGAACATGTTTATCAG
CATCAATTCCACCGTGAAGGAGTGATCTCGGCGATCATCAAACTATCCGAAGGCTCTTTGTCAGGAGACCAGGAG
AACATCGATTCATCCGATCCCTCACGTATAAACACGAGCACAGATTCATCGCGTGGTGCTAATCAAATTGTTGGA
GAGACTGGATCTGGCGGAGATGATGAGGATGAAGACGATGAACCCGATGACTTTGACGACGATGATGGCGAGGAT
GATGACCAAGATGACATGTCTGATTCCGAAGACGACTTCATGGCCGGCCCACGCAGTCGACAAAAGATGGACAAT
GCGCTCAACGACGTAGTTATCCAAGATGCCCAAGCTTTCCTCGAGGTATATGAAGCAAGCCACGGTGAAACCGTT
CGAGCGGAGGCTTTGAGGATCTTGACAGCACTGAAATCCCTCGCCTCCGAAATAAAATCACGCTATTCCCGTGGC
GGTGAGGGTGGTCTTCCCTTATTTAAACAGCTCGCGTCCTACTTTGACGGAGACGCCTTGGAGGGCATTACCAGC
TCAGAATTGCTCAACTCCGGCATTATAGACGTTCTTCTGTGTGTCCTTGGTAACTTTCAATCGCCCTCTATCCGC
GATGCTAGAGCCGACTTCCTGCGGGCGTTTATGGGTGTTTCAATCTCGGACAAGGCCCAAAGCCAGAGCACCGCC
ACGACACCTTTCAGCGTACTTATCCGCAAGTTGCAAGACCTGCTTAGTAGGACGGAACATTTCGAAGTCCTTACC
ATTAGTCACAATTCGCTAGAGAATACCCGCAGCAACGCCGCCTACATGCTGAGCAAACAGCTCCGACTCAAGCTG
GTTGCCGACGAAGGGTCCGAAGTTCCTCGTCCTTATCGCAACATCATGGTGTCAATCCATGCCATTGCTACATTT
AAGGCCTTGGATGATTTCCTTCATCCCCGAATCGCCGTGGCGGAAAAACCTCGCCCCTCACGAACAAGGGACTCA
ATTCTCTCACAAATTGCCAATGCATCCCGACTTCGTGAACAGCTGGCTTCTGGGTCTGGGATGAGCCTCCCAAAT
CCCACAGGGGGTCTCCAGGGCACTATGACCGATCCCACGGATGGTGTCTATGATTCTTCCACCGATCACCCGCAT
CATCATCAGTCCAATCGGATTCAAGAAGATGAAGATGAAGAGGATGAGGAGCCCCTTGAATGCGCCGATGAAAGG
CAACTGACCGACGAAGAAGAAGGCGGCGAAGAAGATGAGGGCGACCAACTCAATGCCATTGTTGATGATCTCGAT
GAGGATATGGAAAATGATGATATCTCTGACCCCTCGGCAGTCAACATGGAGGTGGCATCCTCGGGCAAGGTCACG
GCTCGCAAGGAAGATGGTACCCGAATTGGGACACCCTCCCAGACCGCTGCATCCAAGCCTTCATCGTCAGCTCCT
GCCGCTCTCCCCAGTCACACGCGCAACAGTTCTCTCGCCACTGCCGGGCGCCCGTTCTCATCGTATGCCGCTGCA
ATGGCCTCGGTGCCCCAGGACTGGCACCTTGAGTTTTTCGTAGATGGCAAGCCCGTTACTAATGAGACAACTATC
TACCGTGGTGTTCATCACGACCGTGAGGACTTGGACGAGAGTAGTGCCAAGAACGTCTGGTCGGCAGTCCACACT
ATCACATTTAAGCGCGTTCCTGGTCCTCCGCCGCCAGAGCCCTCAACCCTTACACCGACCGTCCAGGCTTCTTCT
GAGGGTGATGCCCTTGAGATCCCGGCCTCTCTCGACAAAGACCCAACAACTTCATCTATCATTCGCCTGCTTCGT
GTTTTGCACGAAATGAACGCAACGATTGATGATATCTTGACCGATACCAAAGACTCCGCCACCATCACCTCGGAG
CCCTTGGCTCAATTCATTAACACGAAGCTCACCGCCAAGATCAACCGCCAACTCGAGGAGCCGTTGATTGTGGCA
AGCGATTGCCTTCCAAGTTGGAGCGAAGACTTAGCAAGGCTTTTTTCCTTCTTGTTCCCATTCGAGACAAGGCAT
CTATTCCTGCAGTCAACTGCATTTGGCTACTCACGGGCGATGATGAGATGGCAAAATTCTCAAAGTGGTGAAGAC
AGCCGACGGGACTTGCGCCGCGATGATCGCCCATTCCTTGGCCGGCTGCAGCGACAAAAAGTGCGCATCTCTCGT
TCTCGCATCCTTGATTCTGCATTAAAGGTCATGGAACTCTATGGATCTTCCCCCAGCATTCTCGAGGTTGAATAT
TTCGAGGAAGTTGGTACTGGATTAGGACCGACCCTTGAATTCTACTCTACTGTTTCTAGGGAGTTCTCAAAGAAG
AAGCTTAAGATCTGGAGAGACACGGACGGAAGCTCTACCACAGAATATGCATTTGGCAAGTCTGGTCTGTTCCCA
GCGCCGATGAGTGACGAACAAGCATCCCAAGATATCGGGAAGAGGCAATTAAACATCTTCAAGGTCCTAGGGAAG
TTTGTGGCTCGCTCGATGCTTGACTCCAGGATCATCGACATTTCGTTCAATCCAGCATTCTTCCGTATCGCGGAT
ACTCTGTCATCAGTGGCACCATCCCTAGGCACCGTCAAGCTGGTTGACCACGACCTGGCGAAGTCCTTGGTCATG
CTCAAAGAATTTGTCAATGCCAAAAACGTCATTGAGGCAAACCAGTCGCTTTCGCCAGCCCTTAAATCCGAGGCC
GTGCAAAACATCACGGTCCACGGTGCCAGTGTTGACGATCTGGGCTTGGACTTCACTCTACCTGGATATCCTGCG
ATTGAGTTGATCTCTGATGGCGCCAATGTGCCGTTGACAATCGAAAATATTGACACTTACATCGAACGGGTCATC
GACATGACCTTGGGTAGCGGTGTCCGGCGTCAGGTGGATGCCTTCCGGGCTGGGTTCTCACAAGTCTTCCCCTTC
TCCTCCCTTTGTGCTTTCACTCCAAGTGAGCTCGTTATGCTTTTCGGACAAGCGGACGAGGATTGGTCTATCGAG
ACCTTAATGGACTCCATCAAAGCCGATCACGGGTTCAACATGGACAGTCGGAGTGTGCGCAACCTGCTGCAAACT
ATGAGCGAACTGGACAACCAGCAACGCCGAGATTTCCTTCAGTTTGTCACTGGTAGCCCCAAGCTCCCCATTGGA
GGTTTCAAGAGTCTCACGCCGATCTTCACTGTCGTGTGCCGCCCAAGCGAACATCCATATACACCAGACGACTAC
CTCCCCAGTGTGATGACATGCGTCAACTACCTGAAGTTGCCGGACTATAGCGACCTGGACGTACTCAAGAAGCGC
CTCTCAGTTGCCATCAAAGAAGGCCAAGGAGCTTTCCATCTTTCTTAG
Transcript >Pro_DTO377G3_2|g6644.t1
ATGTCATCCAGAATAACTCGCTCCTCCGCGAGACTCGCCACAGACCCTCCACCTGCTGAGTCCGGTACACCGCTT
CAAACACCTGGCTCTACCTCATCCCGGAAACGCAAGGCATCCTCCCGCCACGACCGACAAGCAGACGCCCCGATA
CAGCCAGCACCGGCATCGCCCCAAAGGAAAACCAAGCGACCGCGGACTGCAGCATCTCAAACAGCTCCATCTACT
GGTCCTGTTCCTGCTGCACCCCGTCGAGGAGCCCGCAGCCGTACAGCCATGTCACAACCGGGACCTTCATCTCGA
CCGTCGGAGGAATCATCGAAATCGACGACCTCCCCACAACCATCGAGGCGAAAGTCAAGTCGGAACGACCGACCC
GCGACGACACAGTCCCCGCCGCCCCGACGCCCGAAGAAGCGTTCGGGCAAGTCAAATCCCGATGTTTTGATGAGA
GATGCAGAGGAGGAAATCGAGGAGGAAGAGCATCAGGAAGAACAACAAGGATCTCAAACGGGAGAGAGCAACGAT
GGCACCAATCCCTCGGCGTTCGGTGATGATGATATGGATCCGTTCCACAGCAGCCTATTCGGTGGCAGAGGCCCC
ATGGGACTCCAGAGCACTTTACGTGCCCTCACTGGCATGATGAGTGGCATGTCATCACGTCTTCGAGATATTCTC
ACCAACTTGAGAGCGAAGGATGATCCATCTCTCCAATTGATCGCCTTGCAAGAGCTGTCAGATCTCTTGCTTGTA
TCGAACGAGGATAACCTGTCTGGTCAATTTTCGCCGGACCCGTATGTGAAGGAGCTCGTGACTTTGATGCAGCCA
AATCAGTTTGGCGAAGAAAATCCCGAGATTATGCTTCTTGCATGTCGCTCTCTTGCGAATCTAATGGAGGCCCTA
CGGGGCTCCGTAGCTAATGTTGTATATGGTGGTGCTGTACCCATCCTCTGCCAAAAGCTGCTCGATATACAGTTC
ATCGATCTAGCTGAGCAGGCTTTGAGTACATTGGCCAAGATTTCAGTCGACTTCCCAGCCTCAATCGTGCGAGAA
GGTGGATTGACCGCATGCCTCACGTATCTGGATTTCTTCCCAACCAGTACTCAACGAACAGCAGTTAGTACGGCC
GCTAACTGCTGTCGTAACCTCCCTCATGACTCGTTCCCTGTGGTGCGGGATGTAATGCCCACCCTACTCAACGTC
CTCTCTAGCAATGATCCTAAGGTCGTGGAGCAAGGGTGCCTATGCGTATCACGGATTGTCGAGAGCTTCAAGCAC
CGACCGGAGAACCTGGAGGAGCTGATTGAGCCTGCAATGCTCAAAGCTATCCTTCGGCTTCTACTGCCAGGAACA
ACAAACCTGATCGGGCCTCATATCCACACGCAATTCCTTAGGGTATTGGCAATCGTATCGAGAACAAGCCCACGA
TTGTCAAATGAGCTTCTCAAGATGGATGTAGTGGATACGCTTTACCAAATTTTGACCGGCGTGTCACCACCGCAG
GATGTGGATAACACGGCCGTTAAGATGGACAGCGTGCTAGTCATGCAAGCATTGATTCATCGGCCCCGTGAACAA
GTATATGAAACTCTCAATGTCGTCTGCGAGCTATTGCCAGGCGTTCCAAGCCGCGATGCCTCAAAAACCGACAAC
CTCCTAAGCTCATACTTTGATAGCCACATGTCCATTGGACTGAGATCTCCCAAATCTAAAGAGACAGTGGAGGAA
AGGCGGTCCTTGCTCGTTAATTGCAAGACTGAGCTTAAGCGTTTTGCGATGATTCTGTTCCCAACTTTGACCGAT
GCCTACTCGAGCACGGTCAATCTGCATGTCCGCCAGAAGGTCCTGATTGCACAGCTGAAGATGCTGCATATCCTT
GAGCCTTCTTTGATCGAAGACGCCCTGCGCACAGTCCCTTACGCTTCGTTTTTGGCTGCCATTCTGTCCCAAAAA
GACCACCCTTCTCTCGTATCTTTAGCTCTACGCTGCGCTGAGCTACTGTTCCAGCGGCTTGAACATGTTTATCAG
CATCAATTCCACCGTGAAGGAGTGATCTCGGCGATCATCAAACTATCCGAAGGCTCTTTGTCAGGAGACCAGGAG
AACATCGATTCATCCGATCCCTCACGTATAAACACGAGCACAGATTCATCGCGTGGTGCTAATCAAATTGTTGGA
GAGACTGGATCTGGCGGAGATGATGAGGATGAAGACGATGAACCCGATGACTTTGACGACGATGATGGCGAGGAT
GATGACCAAGATGACATGTCTGATTCCGAAGACGACTTCATGGCCGGCCCACGCAGTCGACAAAAGATGGACAAT
GCGCTCAACGACGTAGTTATCCAAGATGCCCAAGCTTTCCTCGAGGTATATGAAGCAAGCCACGGTGAAACCGTT
CGAGCGGAGGCTTTGAGGATCTTGACAGCACTGAAATCCCTCGCCTCCGAAATAAAATCACGCTATTCCCGTGGC
GGTGAGGGTGGTCTTCCCTTATTTAAACAGCTCGCGTCCTACTTTGACGGAGACGCCTTGGAGGGCATTACCAGC
TCAGAATTGCTCAACTCCGGCATTATAGACGTTCTTCTGTGTGTCCTTGGTAACTTTCAATCGCCCTCTATCCGC
GATGCTAGAGCCGACTTCCTGCGGGCGTTTATGGGTGTTTCAATCTCGGACAAGGCCCAAAGCCAGAGCACCGCC
ACGACACCTTTCAGCGTACTTATCCGCAAGTTGCAAGACCTGCTTAGTAGGACGGAACATTTCGAAGTCCTTACC
ATTAGTCACAATTCGCTAGAGAATACCCGCAGCAACGCCGCCTACATGCTGAGCAAACAGCTCCGACTCAAGCTG
GTTGCCGACGAAGGGTCCGAAGTTCCTCGTCCTTATCGCAACATCATGGTGTCAATCCATGCCATTGCTACATTT
AAGGCCTTGGATGATTTCCTTCATCCCCGAATCGCCGTGGCGGAAAAACCTCGCCCCTCACGAACAAGGGACTCA
ATTCTCTCACAAATTGCCAATGCATCCCGACTTCGTGAACAGCTGGCTTCTGGGTCTGGGATGAGCCTCCCAAAT
CCCACAGGGGGTCTCCAGGGCACTATGACCGATCCCACGGATGGTGTCTATGATTCTTCCACCGATCACCCGCAT
CATCATCAGTCCAATCGGATTCAAGAAGATGAAGATGAAGAGGATGAGGAGCCCCTTGAATGCGCCGATGAAAGG
CAACTGACCGACGAAGAAGAAGGCGGCGAAGAAGATGAGGGCGACCAACTCAATGCCATTGTTGATGATCTCGAT
GAGGATATGGAAAATGATGATATCTCTGACCCCTCGGCAGTCAACATGGAGGTGGCATCCTCGGGCAAGGTCACG
GCTCGCAAGGAAGATGGTACCCGAATTGGGACACCCTCCCAGACCGCTGCATCCAAGCCTTCATCGTCAGCTCCT
GCCGCTCTCCCCAGTCACACGCGCAACAGTTCTCTCGCCACTGCCGGGCGCCCGTTCTCATCGTATGCCGCTGCA
ATGGCCTCGGTGCCCCAGGACTGGCACCTTGAGTTTTTCGTAGATGGCAAGCCCGTTACTAATGAGACAACTATC
TACCGTGGTGTTCATCACGACCGTGAGGACTTGGACGAGAGTAGTGCCAAGAACGTCTGGTCGGCAGTCCACACT
ATCACATTTAAGCGCGTTCCTGGTCCTCCGCCGCCAGAGCCCTCAACCCTTACACCGACCGTCCAGGCTTCTTCT
GAGGGTGATGCCCTTGAGATCCCGGCCTCTCTCGACAAAGACCCAACAACTTCATCTATCATTCGCCTGCTTCGT
GTTTTGCACGAAATGAACGCAACGATTGATGATATCTTGACCGATACCAAAGACTCCGCCACCATCACCTCGGAG
CCCTTGGCTCAATTCATTAACACGAAGCTCACCGCCAAGATCAACCGCCAACTCGAGGAGCCGTTGATTGTGGCA
AGCGATTGCCTTCCAAGTTGGAGCGAAGACTTAGCAAGGCTTTTTTCCTTCTTGTTCCCATTCGAGACAAGGCAT
CTATTCCTGCAGTCAACTGCATTTGGCTACTCACGGGCGATGATGAGATGGCAAAATTCTCAAAGTGGTGAAGAC
AGCCGACGGGACTTGCGCCGCGATGATCGCCCATTCCTTGGCCGGCTGCAGCGACAAAAAGTGCGCATCTCTCGT
TCTCGCATCCTTGATTCTGCATTAAAGGTCATGGAACTCTATGGATCTTCCCCCAGCATTCTCGAGGTTGAATAT
TTCGAGGAAGTTGGTACTGGATTAGGACCGACCCTTGAATTCTACTCTACTGTTTCTAGGGAGTTCTCAAAGAAG
AAGCTTAAGATCTGGAGAGACACGGACGGAAGCTCTACCACAGAATATGCATTTGGCAAGTCTGGTCTGTTCCCA
GCGCCGATGAGTGACGAACAAGCATCCCAAGATATCGGGAAGAGGCAATTAAACATCTTCAAGGTCCTAGGGAAG
TTTGTGGCTCGCTCGATGCTTGACTCCAGGATCATCGACATTTCGTTCAATCCAGCATTCTTCCGTATCGCGGAT
ACTCTGTCATCAGTGGCACCATCCCTAGGCACCGTCAAGCTGGTTGACCACGACCTGGCGAAGTCCTTGGTCATG
CTCAAAGAATTTGTCAATGCCAAAAACGTCATTGAGGCAAACCAGTCGCTTTCGCCAGCCCTTAAATCCGAGGCC
GTGCAAAACATCACGGTCCACGGTGCCAGTGTTGACGATCTGGGCTTGGACTTCACTCTACCTGGATATCCTGCG
ATTGAGTTGATCTCTGATGGCGCCAATGTGCCGTTGACAATCGAAAATATTGACACTTACATCGAACGGGTCATC
GACATGACCTTGGGTAGCGGTGTCCGGCGTCAGGTGGATGCCTTCCGGGCTGGGTTCTCACAAGTCTTCCCCTTC
TCCTCCCTTTGTGCTTTCACTCCAAGTGAGCTCGTTATGCTTTTCGGACAAGCGGACGAGGATTGGTCTATCGAG
ACCTTAATGGACTCCATCAAAGCCGATCACGGGTTCAACATGGACAGTCGGAGTGTGCGCAACCTGCTGCAAACT
ATGAGCGAACTGGACAACCAGCAACGCCGAGATTTCCTTCAGTTTGTCACTGGTAGCCCCAAGCTCCCCATTGGA
GGTTTCAAGAGTCTCACGCCGATCTTCACTGTCGTGTGCCGCCCAAGCGAACATCCATATACACCAGACGACTAC
CTCCCCAGTGTGATGACATGCGTCAACTACCTGAAGTTGCCGGACTATAGCGACCTGGACGTACTCAAGAAGCGC
CTCTCAGTTGCCATCAAAGAAGGCCAAGGAGCTTTCCATCTTTCTTAG
Gene >Pro_DTO377G3_2|g6644.t1
ATGTCATCCAGAATAACTCGCTCCTCCGCGAGACTCGCCACAGACCCTCCACCTGCTGAGTCCGGTACACCGCTT
CAAACACCTGGCTCTACCTCATCCCGGAAACGCAAGGCATCCTCCCGCCACGACCGACAAGCAGACGCCCCGATA
CAGCCAGCACCGGCATCGCCCCAAAGGAAAACCAAGCGACCGCGGACTGCAGCATCTCAAACAGCTCCATCTACT
GGTCCTGTTCCTGCTGCACCCCGTCGAGGAGCCCGCAGCCGTACAGCCATGTCACAACCGGGGTAGGTGATGATG
CACATTGATGGATAAGAACTAGGGCTAACCTCATCTCAGACCTTCATCTCGACCGTCGGAGGAATCATCGAAATC
GACGACCTCCCCACAACCATCGAGGCGAAAGTCAAGTCGGAACGGTGAGTTTTATGGATGACAATCGGCCGTGTC
ACACAAATTTGTATCTGATGTGCTAGTTACTGATCCCTTCTCTTTATTTATAGACCGACCCGCGACGACACAGTC
CCCGCCGCCCCGACGCCCGAAGAAGCGTTCGGGCAAGTCAAATCCCGATGTTTTGATGAGAGATGCAGAGGAGGA
AATCGAGGAGGAAGAGCATCAGGAAGAACAACAAGGATCTCAAACGGGAGAGAGCAACGATGGCACCAATCCCTC
GGCGTTCGGTGATGATGATATGGATCCGTTCCACAGCAGCCTATTCGGTGGCAGAGGCCCCATGGGACTCCAGAG
CACTTTACGTGCCCTCACTGGCATGATGAGTGGCATGTCATCACGTCTTCGAGATATTCTCACCAACTTGAGAGC
GAAGGATGATCCATCTCTCCAATTGATCGCCTTGCAAGAGCTGTCAGATCTCTTGCTTGTATCGAACGAGGATAA
CCTGTCTGGTCAATTTTCGCCGGACCCGTATGTGAAGGAGCTCGTGACTTTGATGCAGCCAAATCAGTTTGGCGA
AGAAAATCCCGAGATTATGCTTCTTGCATGTCGCTCTCTTGCGAATCTAATGGAGGCCCTACGGGGCTCCGTAGC
TAATGTTGTATATGGTGGTGCTGTACCCATCCTCTGCCAAAAGCTGCTCGATATACAGTTCATCGATCTAGCTGA
GCAGGCTTTGAGTACATTGGCCAAGATTTCAGTCGACTTCCCAGCCTCAATCGTGCGAGAAGGTGGATTGACCGC
ATGCCTCACGTATCTGGATTTCTTCCCAACCAGTACTCAACGAACAGCAGTTAGTACGGCCGCTAACTGCTGTCG
TAACCTCCCTCATGACTCGTTCCCTGTGGTGCGGGATGTAATGCCCACCCTACTCAACGTCCTCTCTAGCAATGA
TCCTAAGGTCGTGGAGCAAGGGTGCCTATGCGTATCACGGATTGTCGAGAGCTTCAAGCACCGACCGGAGAACCT
GGAGGAGCTGATTGAGCCTGCAATGCTCAAAGCTATCCTTCGGCTTCTACTGCCAGGAACAACAAACCTGATCGG
GCCTCATATCCACACGCAATTCCTTAGGGTATTGGCAATCGTATCGAGAACAAGCCCACGATTGTCAAATGAGCT
TCTCAAGATGGATGTAGTGGATACGCTTTACCAAATTTTGACCGGCGTGTCACCACCGCAGGATGTGGATAACAC
GGCCGTTAAGATGGACAGCGTGCTAGTCATGCAAGCATTGATTCATCGGCCCCGTGAACAAGTATATGAAACTCT
CAATGTCGTCTGCGAGCTATTGCCAGGCGTTCCAAGCCGCGATGCCTCAAAAACCGACAACCTCCTAAGCTCATA
CTTTGATAGCCACATGTCCATTGGACTGAGATCTCCCAAATCTAAAGAGACAGTGGAGGAAAGGCGGTCCTTGCT
CGTTAATTGCAAGACTGAGCTTAAGCGTTTTGCGATGATTCTGTTCCCAACTTTGACCGATGCCTACTCGAGCAC
GGTCAATCTGCATGTCCGCCAGAAGGTCCTGATTGCACAGCTGAAGATGCTGCATATCCTTGAGCCTTCTTTGAT
CGAAGACGCCCTGCGCACAGTCCCTTACGCTTCGTTTTTGGCTGCCATTCTGTCCCAAAAAGACCACCCTTCTCT
CGTATCTTTAGCTCTACGCTGCGCTGAGCTACTGTTCCAGCGGCTTGAACATGTTTATCAGCATCAATTCCACCG
TGAAGGAGTGATCTCGGCGATCATCAAACTATCCGAAGGCTCTTTGTCAGGAGACCAGGAGAACATCGATTCATC
CGATCCCTCACGTATAAACACGAGCACAGATTCATCGCGTGGTGCTAATCAAATTGTTGGAGAGACTGGATCTGG
CGGAGATGATGAGGATGAAGACGATGAACCCGATGACTTTGACGACGATGATGGCGAGGATGATGACCAAGATGA
CATGTCTGATTCCGAAGACGACTTCATGGCCGGCCCACGCAGTCGACAAAAGATGGACAATGCGCTCAACGACGT
AGTTATCCAAGATGCCCAAGCTTTCCTCGAGGTATATGAAGCAAGCCACGGTGAAACCGTTCGAGCGGAGGCTTT
GAGGATCTTGACAGCACTGAAATCCCTCGCCTCCGAAATAAAATCACGCTATTCCCGTGGCGGTGAGGGTGGTCT
TCCCTTATTTAAACAGCTCGCGTCCTACTTTGACGGAGACGCCTTGGAGGGCATTACCAGCTCAGAATTGCTCAA
CTCCGGCATTATAGACGTTCTTCTGTGTGTCCTTGGTAACTTTCAATCGCCCTCTATCCGCGATGCTAGAGCCGA
CTTCCTGCGGGCGTTTATGGGTGTTTCAATCTCGGACAAGGCCCAAAGCCAGAGCACCGCCACGACACCTTTCAG
CGTACTTATCCGCAAGTTGCAAGACCTGCTTAGTAGGACGGAACATTTCGAAGTCCTTACCATTAGTCACAATTC
GCTAGAGAATACCCGCAGCAACGCCGCCTACATGCTGAGCAAACAGCTCCGACTCAAGCTGGTTGCCGACGAAGG
GTCCGAAGTTCCTCGTCCTTATCGCAACATCATGGTGTCAATCCATGCCATTGCTACATTTAAGGCCTTGGATGA
TTTCCTTCATCCCCGAATCGCCGTGGCGGAAAAACCTCGCCCCTCACGAACAAGGGACTCAATTCTCTCACAAAT
TGCCAATGCATCCCGACTTCGTGAACAGCTGGCTTCTGGGTCTGGGATGAGCCTCCCAAATCCCACAGGGGGTCT
CCAGGGCACTATGACCGATCCCACGGATGGTGTCTATGATTCTTCCACCGATCACCCGCATCATCATCAGTCCAA
TCGGATTCAAGAAGATGAAGATGAAGAGGATGAGGAGCCCCTTGAATGCGCCGATGAAAGGCAACTGACCGACGA
AGAAGAAGGCGGCGAAGAAGATGAGGGCGACCAACTCAATGCCATTGTTGATGATCTCGATGAGGATATGGAAAA
TGATGATATCTCTGACCCCTCGGCAGTCAACATGGAGGTGGCATCCTCGGGCAAGGTCACGGCTCGCAAGGAAGA
TGGTACCCGAATTGGGACACCCTCCCAGACCGCTGCATCCAAGCCTTCATCGTCAGCTCCTGCCGCTCTCCCCAG
TCACACGCGCAACAGTTCTCTCGCCACTGCCGGGCGCCCGTTCTCATCGTATGCCGCTGCAATGGCCTCGGTGCC
CCAGGACTGGCACCTTGAGTTTTTCGTAGATGGCAAGCCCGTTACTAATGAGACAACTATCTACCGTGGTGTTCA
TCACGACCGTGAGGACTTGGACGAGAGTAGTGCCAAGAACGTCTGGTCGGCAGTCCACACTATCACATTTAAGCG
CGTTCCTGGTCCTCCGCCGCCAGAGCCCTCAACCCTTACACCGACCGTCCAGGCTTCTTCTGAGGGTGATGCCCT
TGAGATCCCGGCCTCTCTCGACAAAGACCCAACAACTTCATCTATCATTCGCCTGCTTCGTGTTTTGCACGAAAT
GAACGCAACGATTGATGATATCTTGACCGATACCAAAGACTCCGCCACCATCACCTCGGAGCCCTTGGCTCAATT
CATTAACACGAAGCTCACCGCCAAGATCAACCGCCAACTCGAGGAGCCGTTGATTGTGGCAAGCGATTGCCTTCC
AAGTTGGAGCGAAGACTTAGCAAGGCTTTTTTCCTTCTTGTTCCCATTCGAGACAAGGCATCTATTCCTGCAGTC
AACTGCATTTGGCTACTCACGGGCGATGATGAGATGGCAAAATTCTCAAAGTGGTGAAGACAGCCGACGGGACTT
GCGCCGCGATGATCGCCCATTCCTTGGCCGGCTGCAGCGACAAAAAGTGCGCATCTCTCGTTCTCGCATCCTTGA
TTCTGCATTAAAGGTCATGGAACTCTATGGATCTTCCCCCAGCATTCTCGAGGTTGAATATTTCGAGGAAGTTGG
TACTGGATTAGGACCGACCCTTGAATTCTACTCTACTGTTTCTAGGGAGTTCTCAAAGAAGAAGCTTAAGATCTG
GAGAGACACGGACGGAAGCTCTACCACAGAATATGCATTTGGCAAGTCTGGTCTGTTCCCAGCGCCGATGAGTGA
CGAACAAGCATCCCAAGATATCGGGAAGAGGCAATTAAACATCTTCAAGGTCCTAGGGAAGTTTGTGGCTCGCTC
GATGCTTGACTCCAGGATCATCGACATTTCGTTCAATCCAGCATTCTTCCGTATCGCGGATACTCTGTCATCAGT
GGCACCATCCCTAGGCACCGTCAAGCTGGTTGACCACGACCTGGCGAAGTCCTTGGTCATGCTCAAAGAATTTGT
CAATGCCAAAAACGTCATTGAGGCAAACCAGTCGCTTTCGCCAGCCCTTAAATCCGAGGCCGTGCAAAACATCAC
GGTCCACGGTGCCAGTGTTGACGATCTGGGCTTGGACTTCACTCTACCTGGATATCCTGCGATTGAGTTGATCTC
TGATGGCGCCAATGTGCCGTTGACAATCGAAAATATTGACACTTACATCGAACGGGTCATCGACATGACCTTGGG
TAGCGGTGTCCGGCGTCAGGTGGATGCCTTCCGGGCTGGGTTCTCACAAGTCTTCCCCTTCTCCTCCCTTTGTGC
TTTCACTCCAAGTGAGCTCGTTATGCTTTTCGGACAAGCGGACGAGGATTGGTCTATCGAGACCTTAATGGACTC
CATCAAAGCCGATCACGGGTTCAACATGGACAGTCGGAGTGTGCGCAACCTGCTGCAAACTATGAGCGAACTGGA
CAACCAGCAACGCCGAGATTTCCTTCAGTTTGTCACTGGTAGCCCCAAGCTCCCCATTGGAGGTATGTTTATTTC
ATTTTTCTCCACATAAAATCCCACTAACACAAACTCAAATATAGGTTTCAAGAGTCTCACGCCGATCTTCACTGT
CGTGTGCCGCCCAAGCGAACATCCATATACACCAGACGACTACCTCCCCAGTGTGATGACATGCGTCAACTACCT
GAAGTTGCCGGACTATAGCGACCTGGACGTACTCAAGAAGCGCCTCTCAGTTGCCATCAAAGAAGGCCAAGGAGC
TTTCCATCTTTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail