Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6642.t1
Gene name
Locationscaffold_18:117714..118622
Strand+
Gene length (bp)908
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 3.3E-08 161 228

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 22.22 9.14 35.29
5d_25C Five days - 25 degrees Celsius 20.37 8.00 32.74
7d_25C Seven days - 25 degrees Celsius 15.37 5.80 24.94
10d_25C Ten days - 25 degrees Celsius 10.43 3.29 17.56
7d_15C Seven days - 15 degrees Celsius 11.38 3.31 19.46
7d_30C Seven days - 30 degrees Celsius 19.24 7.86 30.61

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.855480 no
3d_25C 7d_25C 0.300794 no
3d_25C 7d_15C 0.062630 no
3d_25C 7d_30C 0.738650 no
3d_25C 10d_25C 0.025128 yes
5d_25C 7d_25C 0.471864 no
5d_25C 7d_15C 0.118029 no
5d_25C 7d_30C 0.911177 no
5d_25C 10d_25C 0.054411 no
7d_25C 7d_15C 0.478388 no
7d_25C 7d_30C 0.579278 no
7d_25C 10d_25C 0.312771 no
7d_15C 7d_30C 0.163150 no
7d_15C 10d_25C 0.880374 no
7d_30C 10d_25C 0.076254 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6642.t1
MSHISQTARRLFRSQPLSAFRTYSPAAPIARLHEQHPNRSAVVHDQALPSQTDGSPLLSQTQSLHNERTGLDKLV
SHVPLVQKLRGTQSTYKETRPHLAIPPHLRQHHFVGGSLTGVGKLAFAPYMWLSTGKSGTGTDSADRASSVVSVF
HIGQDVCGHPGFVHGGLLTVLFDEVFARCVSAAFPSGLGMTANLNVDFRKPALPDRMYVMRTKTVKVEGRKAWVE
GRMTYLPLTVPLSADGHTIVPDASLLHEDSEGAVMVAEAKALFIEPKFADSMVSVYSS*
Coding >Pro_DTO377G3_2|g6642.t1
ATGTCGCACATTTCACAAACAGCGCGTCGGCTGTTCCGGTCGCAACCCCTTTCAGCATTCAGAACATACTCGCCT
GCGGCGCCTATTGCCCGTCTCCATGAACAACACCCAAACCGGTCGGCGGTCGTTCATGACCAAGCACTCCCTAGC
CAAACCGACGGATCCCCATTACTGTCTCAGACCCAGTCATTGCACAACGAACGGACAGGCCTCGACAAACTTGTT
TCCCATGTCCCTCTCGTCCAGAAATTGCGCGGAACCCAGAGCACCTACAAGGAAACACGTCCCCATCTTGCAATC
CCGCCACACCTTAGACAGCATCACTTCGTGGGCGGCAGCTTGACTGGTGTAGGCAAGCTTGCATTCGCACCATAT
ATGTGGCTCTCGACCGGCAAGTCTGGGACAGGGACCGACAGTGCCGACCGAGCCAGCAGCGTTGTATCAGTATTC
CATATCGGCCAGGACGTCTGTGGTCACCCTGGCTTTGTCCATGGTGGTCTTCTCACTGTTCTTTTTGATGAGGTG
TTTGCGCGCTGTGTCTCTGCGGCTTTCCCCAGCGGGCTGGGCATGACGGCGAATCTTAATGTGGATTTCCGAAAG
CCAGCTCTTCCCGACCGAATGTATGTGATGCGCACAAAGACGGTTAAGGTCGAGGGCAGGAAGGCCTGGGTTGAG
GGCCGCATGACTTATCTTCCTTTGACCGTGCCCCTGTCTGCGGACGGGCATACCATTGTTCCTGATGCTAGTCTG
CTGCATGAGGACAGTGAAGGCGCGGTAATGGTTGCTGAGGCTAAGGCTTTGTTTATTGAGCCCAAGTTTGCAGAC
TCTATGGTGTCGGTTTATTCGAGCTAG
Transcript >Pro_DTO377G3_2|g6642.t1
ATGTCGCACATTTCACAAACAGCGCGTCGGCTGTTCCGGTCGCAACCCCTTTCAGCATTCAGAACATACTCGCCT
GCGGCGCCTATTGCCCGTCTCCATGAACAACACCCAAACCGGTCGGCGGTCGTTCATGACCAAGCACTCCCTAGC
CAAACCGACGGATCCCCATTACTGTCTCAGACCCAGTCATTGCACAACGAACGGACAGGCCTCGACAAACTTGTT
TCCCATGTCCCTCTCGTCCAGAAATTGCGCGGAACCCAGAGCACCTACAAGGAAACACGTCCCCATCTTGCAATC
CCGCCACACCTTAGACAGCATCACTTCGTGGGCGGCAGCTTGACTGGTGTAGGCAAGCTTGCATTCGCACCATAT
ATGTGGCTCTCGACCGGCAAGTCTGGGACAGGGACCGACAGTGCCGACCGAGCCAGCAGCGTTGTATCAGTATTC
CATATCGGCCAGGACGTCTGTGGTCACCCTGGCTTTGTCCATGGTGGTCTTCTCACTGTTCTTTTTGATGAGGTG
TTTGCGCGCTGTGTCTCTGCGGCTTTCCCCAGCGGGCTGGGCATGACGGCGAATCTTAATGTGGATTTCCGAAAG
CCAGCTCTTCCCGACCGAATGTATGTGATGCGCACAAAGACGGTTAAGGTCGAGGGCAGGAAGGCCTGGGTTGAG
GGCCGCATGACTTATCTTCCTTTGACCGTGCCCCTGTCTGCGGACGGGCATACCATTGTTCCTGATGCTAGTCTG
CTGCATGAGGACAGTGAAGGCGCGGTAATGGTTGCTGAGGCTAAGGCTTTGTTTATTGAGCCCAAGTTTGCAGAC
TCTATGGTGTCGGTTTATTCGAGCTAG
Gene >Pro_DTO377G3_2|g6642.t1
ATGTCGCACATTTCACAAACAGCGCGTCGGCTGTTCCGGTCGCAACCCCTTTCAGCATTCAGAACATACTCGCCT
GCGGCGCCTATTGCCCGTCTCCATGAACAACACCCAAACCGGTCGGCGGTCGTTCATGACCAAGCACTCCCTAGC
CAAACCGACGGATCCCCATTACTGTCTCAGACCCAGTCATTGCACAACGAACGGACAGGCCTCGACAAACTTGTT
TCCCATGTCCCTCTCGTCCAGAAATTGCGCGGAACCCAGAGCACCTACAAGGAAACACGTCCCCATCTTGCAATC
CCGCCACACCTTAGACAGCATCACTTCGTGGGCGGCAGCTTGACTGGTGTAGGCAAGCTTGCATTCGCACCATAT
ATGTGGCTCTCGACCGGCAAGTCTGGGACAGGGACCGACAGTGCCGACCGAGCCAGCAGCGTTGTATCAGTATTC
CATATCGGCCAGGACGTCTGTGGTCACCCTGGCTTTGTCCATGGTGGTCTTCTCACTGTTCTTTTTGATGAGGTG
TTTGCGCGCTGTGTCTCTGCGGCTTTCCCCAGCGGGCTGGGCATGACGGCGAATCTTAATGTGGATTTCCGAAAG
CCAGCTCTTCCCGACCGAATGTATGTGATGCGCACAAAGACGGTTAAGGTCGAGGGCAGGAAGGCCTGGGTTGAG
GGCCGCATGACTTATCTTCCTTTGACCGTGCCCCTGTCTGCGGACGGGCATACCATTGTTCCTGATGCTAGTCTG
CTGCATGAGGACAGTGAAGGCGCGGTAATGGTTGCTGAGGCTAAGGCTTTGTTTATTGAGCCCAAGTTTGCAGAC
GTGAGTTCCCCTTTATTCTACCCGTATGTGGTAGATTTAGCTAACAGTTTTCACAGTCTATGGTGTCGGTTTATT
CGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail