Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6636.t1
Gene name
Locationscaffold_18:102588..104094
Strand-
Gene length (bp)1506
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 8.2E-32 267 424
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 1.5E-23 159 255
PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain 1.0E-15 26 155
PF08028 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain 5.5E-06 291 403

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 11.88 4.99 18.77
5d_25C Five days - 25 degrees Celsius 10.79 4.38 17.21
7d_25C Seven days - 25 degrees Celsius 12.35 5.27 19.43
10d_25C Ten days - 25 degrees Celsius 12.91 5.66 20.16
7d_15C Seven days - 15 degrees Celsius 18.14 8.71 27.57
7d_30C Seven days - 30 degrees Celsius 14.74 6.67 22.82

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.838748 no
3d_25C 7d_25C 0.940717 no
3d_25C 7d_15C 0.187531 no
3d_25C 7d_30C 0.562376 no
3d_25C 10d_25C 0.858676 no
5d_25C 7d_25C 0.758271 no
5d_25C 7d_15C 0.092370 no
5d_25C 7d_30C 0.362361 no
5d_25C 10d_25C 0.651564 no
7d_25C 7d_15C 0.235261 no
7d_25C 7d_30C 0.652739 no
7d_25C 10d_25C 0.928913 no
7d_15C 7d_30C 0.560197 no
7d_15C 10d_25C 0.293757 no
7d_30C 10d_25C 0.746625 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6636.t1
MAYNSPNPIPFSEPPYIRGLPSPYITPAHCRFQQACRKFATENLIQYALEWEREGTVPEHVFHTFCKHNMLLPNM
PAPLPVDWLKRLGIHDIMGVKVEDWDYIYTGIYCDEMARSGLSGPSGSLNAGFAFGIAPIYKFGSTELQERFLPA
LLTGKKRGCIAITEPEAGSDVANITTTAVKSSDGQHYILNGSKKWITNGIWSDYATMAVRTGGPGAAGLSVLVVP
LKGHPGVSMRRLKVSGQITGGTTYIELDDVKVPVSNIIGQEGDGMRIIMTNFNHERLVIAVGVTRQARVALSAAF
SYCLKREAFGKTLMDQPVVRHRLAKAGAELESMWAWIEQILYQLVHLSKEEGDRQLGGLTALAKAKSAMVLNECA
QTAVLLFGGSGFTKSGQGELVEAILRDVPGARIPGGSEDVLLDLSVRQLVKLYQAEEKKLSPDAKI*
Coding >Pro_DTO377G3_2|g6636.t1
ATGGCATATAACTCACCAAATCCCATCCCGTTCTCAGAGCCGCCTTACATTCGTGGCCTCCCTTCTCCCTACATT
ACGCCTGCCCACTGCCGCTTTCAACAAGCATGTCGTAAATTTGCAACAGAAAACTTGATTCAGTATGCGTTGGAG
TGGGAGCGTGAAGGAACAGTCCCCGAGCATGTCTTCCACACATTCTGCAAGCATAATATGCTGTTGCCCAACATG
CCAGCCCCATTACCCGTGGACTGGCTGAAGCGACTGGGAATCCACGATATCATGGGTGTCAAGGTTGAAGACTGG
GACTATATCTACACTGGAATTTACTGTGATGAGATGGCCCGTTCCGGTCTCAGTGGCCCCTCCGGCTCTCTGAAT
GCTGGCTTCGCTTTTGGAATTGCACCAATCTATAAATTTGGCAGTACTGAGCTGCAAGAGCGGTTCTTGCCTGCG
CTCCTCACAGGTAAGAAGCGAGGCTGCATTGCTATCACAGAGCCCGAGGCTGGTAGTGATGTCGCAAATATCACC
ACAACAGCTGTCAAGAGTTCCGATGGACAGCACTACATCCTGAACGGATCAAAGAAATGGATCACGAATGGTATC
TGGTCGGATTATGCGACCATGGCCGTGCGAACCGGTGGACCAGGAGCCGCGGGCCTTTCGGTTTTGGTTGTACCT
CTAAAGGGCCACCCCGGTGTCTCAATGCGCCGACTCAAAGTCTCAGGTCAGATCACAGGCGGGACCACATACATT
GAGCTCGACGACGTCAAGGTTCCTGTATCAAACATTATTGGTCAAGAAGGAGACGGCATGCGTATCATAATGACC
AACTTCAACCATGAGCGACTTGTTATTGCCGTTGGAGTTACTCGGCAGGCTCGTGTGGCCCTTTCTGCGGCTTTT
TCATACTGCCTCAAGCGTGAGGCTTTTGGAAAGACACTCATGGACCAACCCGTGGTCCGCCACCGTCTAGCTAAG
GCAGGCGCCGAGCTGGAATCCATGTGGGCGTGGATTGAGCAGATCTTGTACCAATTGGTCCATCTCAGCAAAGAG
GAAGGTGACCGCCAACTTGGTGGTTTGACGGCCCTGGCTAAAGCAAAGTCTGCTATGGTTTTGAATGAGTGTGCC
CAAACAGCCGTGTTGTTGTTTGGGGGGAGTGGATTTACCAAATCTGGTCAGGGTGAATTGGTCGAAGCCATTCTT
CGCGATGTTCCTGGTGCCCGTATTCCGGGTGGATCAGAAGATGTGCTGCTTGATTTGTCTGTGCGTCAATTGGTC
AAGCTCTATCAGGCTGAAGAGAAGAAGTTGTCACCAGACGCCAAGATTTGA
Transcript >Pro_DTO377G3_2|g6636.t1
ATGGCATATAACTCACCAAATCCCATCCCGTTCTCAGAGCCGCCTTACATTCGTGGCCTCCCTTCTCCCTACATT
ACGCCTGCCCACTGCCGCTTTCAACAAGCATGTCGTAAATTTGCAACAGAAAACTTGATTCAGTATGCGTTGGAG
TGGGAGCGTGAAGGAACAGTCCCCGAGCATGTCTTCCACACATTCTGCAAGCATAATATGCTGTTGCCCAACATG
CCAGCCCCATTACCCGTGGACTGGCTGAAGCGACTGGGAATCCACGATATCATGGGTGTCAAGGTTGAAGACTGG
GACTATATCTACACTGGAATTTACTGTGATGAGATGGCCCGTTCCGGTCTCAGTGGCCCCTCCGGCTCTCTGAAT
GCTGGCTTCGCTTTTGGAATTGCACCAATCTATAAATTTGGCAGTACTGAGCTGCAAGAGCGGTTCTTGCCTGCG
CTCCTCACAGGTAAGAAGCGAGGCTGCATTGCTATCACAGAGCCCGAGGCTGGTAGTGATGTCGCAAATATCACC
ACAACAGCTGTCAAGAGTTCCGATGGACAGCACTACATCCTGAACGGATCAAAGAAATGGATCACGAATGGTATC
TGGTCGGATTATGCGACCATGGCCGTGCGAACCGGTGGACCAGGAGCCGCGGGCCTTTCGGTTTTGGTTGTACCT
CTAAAGGGCCACCCCGGTGTCTCAATGCGCCGACTCAAAGTCTCAGGTCAGATCACAGGCGGGACCACATACATT
GAGCTCGACGACGTCAAGGTTCCTGTATCAAACATTATTGGTCAAGAAGGAGACGGCATGCGTATCATAATGACC
AACTTCAACCATGAGCGACTTGTTATTGCCGTTGGAGTTACTCGGCAGGCTCGTGTGGCCCTTTCTGCGGCTTTT
TCATACTGCCTCAAGCGTGAGGCTTTTGGAAAGACACTCATGGACCAACCCGTGGTCCGCCACCGTCTAGCTAAG
GCAGGCGCCGAGCTGGAATCCATGTGGGCGTGGATTGAGCAGATCTTGTACCAATTGGTCCATCTCAGCAAAGAG
GAAGGTGACCGCCAACTTGGTGGTTTGACGGCCCTGGCTAAAGCAAAGTCTGCTATGGTTTTGAATGAGTGTGCC
CAAACAGCCGTGTTGTTGTTTGGGGGGAGTGGATTTACCAAATCTGGTCAGGGTGAATTGGTCGAAGCCATTCTT
CGCGATGTTCCTGGTGCCCGTATTCCGGGTGGATCAGAAGATGTGCTGCTTGATTTGTCTGTGCGTCAATTGGTC
AAGCTCTATCAGGCTGAAGAGAAGAAGTTGTCACCAGACGCCAAGATTTGA
Gene >Pro_DTO377G3_2|g6636.t1
ATGGCATATAACTCACCAAATCCCATCCCGTTCTCAGAGCCGCCTTACATTCGTGGCCTCCCTTCTCCCTACATT
ACGCCTGCCCACTGCCGCTTTCAACAAGCATGTCGTAAATTTGCAACAGAAAACTTGATTCAGTATGCGTTGGAG
TGGGAGCGTGAAGGAACAGTCCCCGAGCATGTCTTCCACACATTCTGCAAGCATAATATGCTGTTGCCCAACATG
CCAGCCCCATTACCCGTGGACTGGCTGAAGCGACTGGGAATCCACGATATCATGGGTGTCAAGGTTGAAGACTGG
GACTATATCTACACTGGAATTTACTGTGATGAGGTACGCCATGAGCATCAGCTATCTAACTACGCTTTATAATTG
CTAGGTAATTGACCGATGGTTTGCCAATAGATGGCCCGTTCCGGTCTCAGTGGCCCCTCCGGCTCTCTGAATGCT
GGCTTCGCTTTTGGAATTGCACCAATCTATAAATTTGGCAGTACTGAGCTGCAAGAGCGGTTCTTGCCTGCGCTC
CTCACAGGTAAGAAGCGAGGCTGCATTGCTATCACAGAGCCCGAGGCTGGTAGTGATGTCGCAAATATCACCACA
ACAGCTGTCAAGAGTTCCGATGGACAGCACTACATCCTGAACGGATCAAAGAAATGGCAAGAGACAACTCTACAG
TAATAATAGAGCTATGAGCTGACACCAATAACCAGGATCACGAATGGTATCTGGTCGGATTATGCGACCATGGCC
GTGCGAACCGGTGGACCAGGAGCCGCGGGCCTTTCGGTTTTGGTTGTACCTCTAAAGGGCCACCCCGGTGTCTCA
ATGCGCCGACTCAAAGTCTCAGGTCAGATCACAGGCGGGACCACATACATTGAGCTCGACGACGTCAAGGTTCCT
GTATCAAACATTATTGGTCAAGAAGGAGACGGCATGCGTATCATAATGACCAACTTCAACCATGAGCGACTTGTT
ATTGCCGTTGGAGTTACTCGGCAGGCTCGTGTGGCCCTTTCTGCGGCTTTTTCATACTGCCTCAAGCGTGAGGCT
TTTGGAAAGACACTCATGGACCAACCCGTGGTCCGCCACCGTCTAGCTAAGGCAGGCGCCGAGCTGGAATCCATG
TGGGCGTGGATTGAGCAGATCTTGTACCAATTGGTCCATCTCAGCAAAGAGGAAGGTGACCGCCAACTTGGTGGT
TTGACGGCCCTGGCTAAAGCAAAGTCTGCTATGGTTTTGAATGAGTGTGCCCAAACAGCCGTGTTGTTGTTTGGG
GGGAGTGGATTTACCAAATCTGGTCAGGGTGAATTGGTCGAAGGTATGTTCGCCGGAGTATTGGTATGTACTTGG
AACAAGCTAACTATGCCTCTAGCCATTCTTCGCGATGTTCCTGGTGCCCGTATTCCGGGTGGATCAGAAGATGTG
CTGCTTGATTTGTCTGTGCGTCAATTGGTCAAGCTCTATCAGGCTGAAGAGAAGAAGTTGTCACCAGACGCCAAG
ATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail