Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6625.t1
Gene name
Locationscaffold_18:80122..82026
Strand-
Gene length (bp)1904
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 4.4E-247 14 583

GO

GO Term Description Terminal node
GO:0016255 attachment of GPI anchor to protein Yes
GO:0042765 GPI-anchor transamidase complex Yes
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:1905368 peptidase complex No
GO:0008150 biological_process No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:1902494 catalytic complex No
GO:0043412 macromolecule modification No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0008303 caspase complex No
GO:0006807 nitrogen compound metabolic process No
GO:1905369 endopeptidase complex No
GO:0098796 membrane protein complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 536 558 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6625.t1
MTVLSLFSLPFVALILSLWSSSAFASSDYHEHLLLQPLPQSSLLASFNFRSNTSQQSFDQQHFRYLPRALGQILQ
HAHTKELHLRFTTGRWDAESWGTRPWNGSKEGGTGVELWAWIDAPDDEEAFAKWITLTQSLSGLFCASLNFVDST
RTTRPVVSFEPAGDHSAADQLHLLHGTLPGEVVCTENLTPFLKLLPCKGKAGISSLFDGHKLFDAAWQSMSVDIQ
PVCSADGECVVQIEQTVDMVLDIDRSKRSRSNPIPRPVPNEQLVCDTSKPYNSDDTCYPVEKTSEKAWSLAEIFG
RSLNGVCPLTDFDGSSDQSVCLRVPHERGVFISEEANEIKKDDGFTRCFKLAPSVPFDLSIPQQPANTEVPLDEP
VLHAERTIVGHGQERGGMRIIFGNPSNTSAVDFIYFESLPWFLRPYIHTLHATITGHDGVLREVPASEIVKETYY
RPAIDRERGTQLELALSVPAASTVTLTYDFEKAILRYTEYPPDANRGFNVAPAVIRILDTAHNVPIYIRSTSLLL
QLPTPDFSMPYNVIILTSTVIALAFGTIFNILVRRVVSLDEAAALGAQTLKGRILGKLVAIRDRLRGKDTKMD*
Coding >Pro_DTO377G3_2|g6625.t1
ATGACGGTCCTTTCACTATTCTCACTTCCTTTTGTCGCGCTTATTCTCTCATTATGGAGCTCCTCTGCCTTTGCG
TCATCGGACTATCATGAGCACCTCCTCCTTCAACCTCTCCCGCAGTCCTCCTTGCTAGCTTCTTTTAACTTCCGA
AGTAATACGTCGCAACAATCATTCGACCAACAGCATTTTAGATATTTGCCTCGCGCGCTTGGTCAGATTCTCCAA
CACGCCCACACAAAAGAATTACACCTCCGCTTCACCACCGGCAGATGGGACGCTGAAAGCTGGGGCACACGACCA
TGGAACGGCAGTAAAGAAGGAGGCACTGGCGTCGAGCTTTGGGCGTGGATTGATGCGCCGGATGATGAAGAGGCT
TTTGCCAAATGGATCACTCTGACACAGTCCCTCTCTGGTCTATTCTGCGCCTCACTGAACTTCGTGGACTCGACC
CGGACCACTCGACCTGTTGTTTCTTTTGAACCGGCTGGGGATCACTCAGCTGCTGATCAGCTGCACCTTTTGCAT
GGAACGCTTCCTGGAGAGGTAGTTTGCACAGAGAATTTGACTCCTTTCTTGAAGCTGCTTCCTTGCAAAGGCAAG
GCTGGAATCTCTTCACTATTTGATGGGCACAAACTGTTCGATGCCGCGTGGCAGAGTATGTCCGTCGATATCCAG
CCAGTCTGTTCTGCAGATGGAGAATGTGTGGTTCAGATCGAGCAAACCGTGGACATGGTCTTGGATATTGATCGC
TCCAAGCGCTCTCGTTCGAACCCAATTCCTCGGCCTGTGCCTAATGAGCAGCTGGTTTGCGACACTTCCAAGCCC
TATAATTCGGATGATACCTGCTATCCGGTGGAGAAGACAAGCGAGAAGGCATGGAGTCTTGCGGAAATTTTTGGG
CGAAGCCTAAATGGTGTTTGTCCTCTCACAGATTTCGATGGGTCTAGCGACCAGAGTGTCTGCCTTCGAGTGCCC
CACGAACGGGGTGTCTTCATATCCGAGGAGGCCAATGAAATCAAGAAAGATGATGGCTTTACACGCTGTTTCAAA
TTGGCGCCCTCGGTTCCCTTTGATCTTTCGATCCCGCAGCAGCCAGCCAACACTGAAGTTCCATTGGACGAGCCT
GTTTTGCATGCGGAGCGAACTATCGTTGGCCACGGCCAGGAGCGCGGTGGAATGCGCATTATCTTTGGCAATCCA
TCCAACACCAGCGCAGTTGACTTTATCTACTTCGAATCTCTTCCGTGGTTCCTGCGACCATATATACACACTTTG
CATGCAACAATCACAGGACACGATGGAGTCTTGCGTGAGGTCCCAGCCTCTGAAATCGTCAAAGAAACGTACTAC
CGGCCTGCTATTGATCGCGAGCGCGGAACACAATTAGAACTGGCGCTGTCAGTCCCCGCAGCATCAACTGTCACG
CTGACTTACGATTTCGAGAAGGCCATTCTTCGGTACACCGAGTACCCGCCTGATGCTAATCGAGGGTTCAACGTT
GCACCTGCGGTAATTCGGATCTTGGATACGGCCCATAATGTGCCGATCTACATTCGTTCAACAAGTCTGCTGCTT
CAACTTCCAACCCCGGATTTCAGCATGCCGTACAATGTGATCATTCTTACTAGTACTGTTATTGCACTTGCTTTT
GGAACTATCTTCAACATCCTGGTTCGACGAGTTGTCTCTCTAGATGAGGCTGCCGCTCTCGGAGCCCAGACCCTC
AAAGGCCGGATACTGGGGAAATTGGTGGCCATTCGTGATCGACTCCGCGGCAAGGATACCAAAATGGATTAG
Transcript >Pro_DTO377G3_2|g6625.t1
ATGACGGTCCTTTCACTATTCTCACTTCCTTTTGTCGCGCTTATTCTCTCATTATGGAGCTCCTCTGCCTTTGCG
TCATCGGACTATCATGAGCACCTCCTCCTTCAACCTCTCCCGCAGTCCTCCTTGCTAGCTTCTTTTAACTTCCGA
AGTAATACGTCGCAACAATCATTCGACCAACAGCATTTTAGATATTTGCCTCGCGCGCTTGGTCAGATTCTCCAA
CACGCCCACACAAAAGAATTACACCTCCGCTTCACCACCGGCAGATGGGACGCTGAAAGCTGGGGCACACGACCA
TGGAACGGCAGTAAAGAAGGAGGCACTGGCGTCGAGCTTTGGGCGTGGATTGATGCGCCGGATGATGAAGAGGCT
TTTGCCAAATGGATCACTCTGACACAGTCCCTCTCTGGTCTATTCTGCGCCTCACTGAACTTCGTGGACTCGACC
CGGACCACTCGACCTGTTGTTTCTTTTGAACCGGCTGGGGATCACTCAGCTGCTGATCAGCTGCACCTTTTGCAT
GGAACGCTTCCTGGAGAGGTAGTTTGCACAGAGAATTTGACTCCTTTCTTGAAGCTGCTTCCTTGCAAAGGCAAG
GCTGGAATCTCTTCACTATTTGATGGGCACAAACTGTTCGATGCCGCGTGGCAGAGTATGTCCGTCGATATCCAG
CCAGTCTGTTCTGCAGATGGAGAATGTGTGGTTCAGATCGAGCAAACCGTGGACATGGTCTTGGATATTGATCGC
TCCAAGCGCTCTCGTTCGAACCCAATTCCTCGGCCTGTGCCTAATGAGCAGCTGGTTTGCGACACTTCCAAGCCC
TATAATTCGGATGATACCTGCTATCCGGTGGAGAAGACAAGCGAGAAGGCATGGAGTCTTGCGGAAATTTTTGGG
CGAAGCCTAAATGGTGTTTGTCCTCTCACAGATTTCGATGGGTCTAGCGACCAGAGTGTCTGCCTTCGAGTGCCC
CACGAACGGGGTGTCTTCATATCCGAGGAGGCCAATGAAATCAAGAAAGATGATGGCTTTACACGCTGTTTCAAA
TTGGCGCCCTCGGTTCCCTTTGATCTTTCGATCCCGCAGCAGCCAGCCAACACTGAAGTTCCATTGGACGAGCCT
GTTTTGCATGCGGAGCGAACTATCGTTGGCCACGGCCAGGAGCGCGGTGGAATGCGCATTATCTTTGGCAATCCA
TCCAACACCAGCGCAGTTGACTTTATCTACTTCGAATCTCTTCCGTGGTTCCTGCGACCATATATACACACTTTG
CATGCAACAATCACAGGACACGATGGAGTCTTGCGTGAGGTCCCAGCCTCTGAAATCGTCAAAGAAACGTACTAC
CGGCCTGCTATTGATCGCGAGCGCGGAACACAATTAGAACTGGCGCTGTCAGTCCCCGCAGCATCAACTGTCACG
CTGACTTACGATTTCGAGAAGGCCATTCTTCGGTACACCGAGTACCCGCCTGATGCTAATCGAGGGTTCAACGTT
GCACCTGCGGTAATTCGGATCTTGGATACGGCCCATAATGTGCCGATCTACATTCGTTCAACAAGTCTGCTGCTT
CAACTTCCAACCCCGGATTTCAGCATGCCGTACAATGTGATCATTCTTACTAGTACTGTTATTGCACTTGCTTTT
GGAACTATCTTCAACATCCTGGTTCGACGAGTTGTCTCTCTAGATGAGGCTGCCGCTCTCGGAGCCCAGACCCTC
AAAGGCCGGATACTGGGGAAATTGGTGGCCATTCGTGATCGACTCCGCGGCAAGGATACCAAAATGGATTAG
Gene >Pro_DTO377G3_2|g6625.t1
ATGACGGTCCTTTCACTATTCTCACTTCCTTTTGTCGCGCTTATTCTCTCATTATGGAGCTCCTCTGCCTTTGCG
TCATCGGACTATCATGAGCACCTCCTCCTTCAACCTCTCCCGCAGTCCTCCTTGCTAGCTTCTTTTAACTTCCGA
AGTAATACGTCGCAACAATCATTCGACCAACAGCATTTTAGATATTTGCCTCGCGCGCTTGGTCAGATTCTCCAA
CACGCCCACACAAAAGAATTACACCTCCGCTTCACCACCGGCAGATGGGACGCTGAAAGCTGGGGCACACGACCA
TGGAACGGCAGTAAAGAAGGAGGCACTGGCGTCGAGCTTTGGGCGTGGATTGATGCGCCGGATGATGAAGAGTAT
GCTCCTCACTCGAAATATGTTATAAAAGACACACAATGCTGATTGACTAGGGCTTTTGCCAAATGGATCACTCTG
ACACAGTCCCTCTCTGGTCTATTCTGCGCCTCACTGAACTTCGTGGACTCGACCCGGACCACTCGACCTGTTGTT
TCTTTTGAACCGGCTGGGGATCACTCAGCTGCTGATCAGCTGCACCTTTTGCATGGAACGCTTCCTGGAGAGGTA
GTTTGCACAGAGAATTTGACTCCTTTCTTGAAGCTGCTTCCTTGCAAAGGCAAGGCTGGAATCTCTTCACTATTT
GATGGGCACAAACTGTTCGATGCCGCGTGGCAGAGTATGTCCGTCGATATCCAGCCAGTCTGTTCTGCAGATGGA
GAATGTGTGGTTCAGATCGAGCAAACCGTGGACATGGTCTTGGATATTGATCGCTCCAAGCGCTCTCGTTGTGCG
TACTTTTCACCGGCATACTCTGCCTCAAGATTGCTAACATGGATCTAGCGAACCCAATTCCTCGGCCTGTGCCTA
ATGAGCAGCTGGTTTGCGACACTTCCAAGCCCTATAATTCGGATGATACCTGCTATCCGGTGGAGAAGACAAGCG
AGAAGGCATGGAGTCTTGCGGAAATTTTTGGGCGAAGCCTAAATGGTGTTTGTCCTCTCACAGATTTCGATGGGT
CTAGCGACCAGAGTGTCTGCCTTCGAGTGCCCCACGAACGGGGTGTCTTCATATCCGAGGAGGCCAATGAAATCA
AGAAAGATGATGGCTTTACACGCTGTTTCAAATTGGCGCCCTCGGTTCCCTTTGATCTTTCGATCCCGCAGCAGC
CAGCCAACACTGAAGTTCCATTGGACGAGCCTGTTTTGCATGCGGAGCGAACTATCGTTGGCCACGGCCAGGAGC
GCGGTGGAATGCGCATTATCTTTGGCAATCCATCCAACACCAGCGCAGTTGACTTTATCTACTTCGAATCTCTTC
CGTGGTTCCTGCGACCATATATACACACTTTGCATGCAACAATCACAGGACACGATGGAGTCTTGCGTGAGGTCC
CAGCCTCTGAAATCGTCAAAGAAACGTACTACCGGCCTGCTATTGATCGCGAGCGCGGAACACAATTAGAACTGG
CGCTGTCAGTCCCCGCAGCATCAACTGTCACGCTGACTTACGATTTCGAGAAGGCCATTCTTCGGTACACCGAGT
ACCCGCCTGATGCTAATCGAGGGTTCAACGTTGCACCTGCGGTAATTCGGATCTTGGATACGGCCCATAATGTGC
CGATCTACATTCGTTCAACAAGTCTGCTGCTTCAACTTCCAACCCCGGATTTCAGCATGCCGTACAATGTGATCA
TTCTTACTAGTACTGTTATTGCACTTGCTTTTGGAACTATCTTCAACATCCTGGTTCGACGAGTTGTCTCTCTAG
ATGAGGCTGCCGCTCTCGGAGCCCAGACCCTCAAAGGCCGGATACTGGGGAAATTGGTGGCCATTCGTGATCGAC
TCCGCGGCAAGGATACCAAAATGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail