Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g662.t1
Gene name
Locationscaffold_01:1709129..1710023
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.5E-34 17 199
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 7.6E-26 23 199

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 19 41 22
2 208 230 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.58 0.32 4.84
5d_25C Five days - 25 degrees Celsius 2.51 0.29 4.73
7d_25C Seven days - 25 degrees Celsius 9.06 2.21 15.90
10d_25C Ten days - 25 degrees Celsius 4.64 0.74 8.54
7d_15C Seven days - 15 degrees Celsius 13.02 3.42 22.63
7d_30C Seven days - 30 degrees Celsius 5.25 1.20 9.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.973603 no
3d_25C 7d_25C 0.005626 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.134803 no
3d_25C 10d_25C 0.263090 no
5d_25C 7d_25C 0.003197 yes
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.116026 no
5d_25C 10d_25C 0.235261 no
7d_25C 7d_15C 0.455801 no
7d_25C 7d_30C 0.228516 no
7d_25C 10d_25C 0.150326 no
7d_15C 7d_30C 0.025858 yes
7d_15C 10d_25C 0.017485 yes
7d_30C 10d_25C 0.851180 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g662.t1
MTSLNIKEEDIPRLDGKVVVISGGASGIGLAAANIFARAGAKIFLFDRNPPDSGEAPENSTFIKADITSWAELKA
AFAQAGHVDIAVANAGVSEEQPYFEDTFDEQGELKEPGFAVVDVNFKGTVMFTKLAVSYMRKQGKGGSVVITASA
TGYAPEQNLPVYSAIKSGLVGLVRSLRSTLPRFDISINAVAPAATITKLLPMDIAGPLMAAGLPVSSAHMVGLAV
VYSAVARQPRMVETYGKENVLDLESKWNGRTILTLGEHYTELEEKLADLRPVWFGWRNTDLTKKQQATADFR*
Coding >Pro_DTO377G3_2|g662.t1
ATGACATCTCTCAACATCAAAGAAGAAGACATCCCGCGGCTCGACGGCAAAGTGGTCGTCATTAGCGGCGGAGCC
TCCGGTATTGGGCTTGCCGCTGCAAATATCTTTGCAAGAGCCGGAGCCAAAATCTTCCTGTTTGACCGCAACCCT
CCCGACAGTGGCGAAGCGCCTGAAAATTCGACTTTCATCAAGGCCGACATCACATCTTGGGCTGAACTCAAAGCT
GCTTTTGCCCAAGCAGGCCATGTCGACATTGCCGTGGCCAACGCTGGCGTCTCCGAAGAACAGCCATACTTCGAG
GATACTTTTGACGAGCAGGGCGAACTCAAGGAGCCTGGATTCGCGGTGGTAGACGTCAATTTCAAAGGTACCGTC
ATGTTTACCAAACTGGCGGTCAGCTACATGCGAAAACAAGGGAAGGGTGGCTCCGTTGTGATCACTGCTAGTGCG
ACTGGATACGCGCCTGAACAGAACTTGCCGGTGTATAGTGCTATCAAGTCGGGTCTGGTCGGTCTCGTTCGTTCT
TTGCGTTCGACGCTCCCCCGTTTCGATATCTCAATCAATGCAGTTGCGCCAGCGGCAACCATCACGAAGCTACTC
CCCATGGATATTGCCGGGCCGCTCATGGCAGCCGGACTGCCCGTCAGTTCTGCTCACATGGTGGGTCTGGCAGTG
GTTTATTCTGCCGTGGCCCGTCAGCCACGGATGGTTGAGACTTACGGCAAAGAGAATGTGCTAGATCTGGAAAGC
AAGTGGAACGGGCGCACAATTTTGACGTTGGGAGAACACTACACTGAATTGGAGGAAAAGTTGGCTGATCTGCGG
CCGGTCTGGTTTGGCTGGCGGAACACTGACTTGACCAAAAAGCAGCAAGCTACAGCAGACTTCAGGTAG
Transcript >Pro_DTO377G3_2|g662.t1
ATGACATCTCTCAACATCAAAGAAGAAGACATCCCGCGGCTCGACGGCAAAGTGGTCGTCATTAGCGGCGGAGCC
TCCGGTATTGGGCTTGCCGCTGCAAATATCTTTGCAAGAGCCGGAGCCAAAATCTTCCTGTTTGACCGCAACCCT
CCCGACAGTGGCGAAGCGCCTGAAAATTCGACTTTCATCAAGGCCGACATCACATCTTGGGCTGAACTCAAAGCT
GCTTTTGCCCAAGCAGGCCATGTCGACATTGCCGTGGCCAACGCTGGCGTCTCCGAAGAACAGCCATACTTCGAG
GATACTTTTGACGAGCAGGGCGAACTCAAGGAGCCTGGATTCGCGGTGGTAGACGTCAATTTCAAAGGTACCGTC
ATGTTTACCAAACTGGCGGTCAGCTACATGCGAAAACAAGGGAAGGGTGGCTCCGTTGTGATCACTGCTAGTGCG
ACTGGATACGCGCCTGAACAGAACTTGCCGGTGTATAGTGCTATCAAGTCGGGTCTGGTCGGTCTCGTTCGTTCT
TTGCGTTCGACGCTCCCCCGTTTCGATATCTCAATCAATGCAGTTGCGCCAGCGGCAACCATCACGAAGCTACTC
CCCATGGATATTGCCGGGCCGCTCATGGCAGCCGGACTGCCCGTCAGTTCTGCTCACATGGTGGGTCTGGCAGTG
GTTTATTCTGCCGTGGCCCGTCAGCCACGGATGGTTGAGACTTACGGCAAAGAGAATGTGCTAGATCTGGAAAGC
AAGTGGAACGGGCGCACAATTTTGACGTTGGGAGAACACTACACTGAATTGGAGGAAAAGTTGGCTGATCTGCGG
CCGGTCTGGTTTGGCTGGCGGAACACTGACTTGACCAAAAAGCAGCAAGCTACAGCAGACTTCAGGTAG
Gene >Pro_DTO377G3_2|g662.t1
ATGACATCTCTCAACATCAAAGAAGAAGACATCCCGCGGCTCGACGGCAAAGTGGTCGTCATTAGCGGCGGAGCC
TCCGGTATTGGGCTTGCCGCTGCAAATATCTTTGCAAGAGCCGGAGCCAAAATCTTCCTGTTTGACCGCAACCCT
CCCGACAGTGGCGAAGCGCCTGAAAATTCGACTTTCATCAAGGCCGACATCACATCTTGGGCTGAACTCAAAGCT
GCTTTTGCCCAAGCAGGCCATGTCGACATTGCCGTGGCCAACGCTGGCGTCTCCGAAGAACAGCCATACTTCGAG
GATACTTTTGACGAGCAGGGCGAACTCAAGGAGCCTGGATTCGCGGTGGTAGACGTCAATTTCAAAGGTACCGTC
ATGTTTACCAAACTGGCGGTCAGCTACATGCGAAAACAAGGGAAGGGTGGCTCCGTTGTGATCACTGCTAGTGCG
ACTGGATACGCGCCTGAACAGAACTTGCCGGTGTATAGTGCTATCAAGTCGGGTCTGGTCGGTCTCGTTCGTTCT
TTGCGTTCGACGCTCCCCCGTTTCGATATCTCAATCAATGCAGTTGCGCCAGCGGCAACCATCACGAAGCTACTC
CCCATGGATATTGCCGGGCCGCTCATGGCAGCCGGACTGCCCGTCAGTTCTGCTCACATGGTGGGTCTGGCAGTG
GTTTATTCTGCCGTGGCCCGTCAGCCACGGATGGTTGAGACTTACGGCAAAGAGAATGTGCTAGATCTGGAAAGC
AAGTGGAACGGGCGCACAATTTTGACGTTGGGAGAACACTACACTGAATTGGAGGAAAAGTTGGCTGATCTGCGG
CCGGTCTGGTTTGGCTGGCGGAACACTGACTTGACCAAAAAGCAGCAAGCTACAGCAGACTTCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail