Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6610.t1
Gene name
Locationscaffold_18:49196..51013
Strand-
Gene length (bp)1817
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04163 Tht1 Tht1-like nuclear fusion protein 4.9E-06 166 214

GO

GO Term Description Terminal node
GO:0000742 karyogamy involved in conjugation with cellular fusion Yes
GO:0048288 nuclear membrane fusion involved in karyogamy Yes
GO:0048284 organelle fusion No
GO:0008150 biological_process No
GO:0071763 nuclear membrane organization No
GO:0009987 cellular process No
GO:0061025 membrane fusion No
GO:0000741 karyogamy No
GO:0061024 membrane organization No
GO:0022414 reproductive process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0090174 organelle membrane fusion No
GO:0000740 nuclear membrane fusion No
GO:0071840 cellular component organization or biogenesis No
GO:0006997 nucleus organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 467 489 22
2 496 514 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6610.t1
MRATDRFQVIAYIFLALTHLGRASVSQHNVPILATRPPDIDTVSFLSSRAQDQDSIFNEAVKILDSMQSSPSCNR
LAATKLVNSCQTFSDGKDGTQTDNPETLDVLRSVYAVRLALCEIDGAGTQMPPSCLPVTVSPPPQKNRFGFVSRH
RGPDPMSDEVPKELLEQCLRTLESRPQWWTSYSNSRQNALVICHASRIETEKEELIELQRSIAKSSLKLNNGLQE
ALRNAIAQSAQQQSFIHALQSLQGKIVTDMEATDSVFKRTFGKFLREIEAGIWSLQDSISEALSNVRAGTGVLEG
DIRNVSTQVGALQQALRSAHQDAMTRSRETLLAQETNVVAQKNLASSLHLSLESLLDSDMDKLYQGMQRFDAAME
WLASRMNMILEQETRMTERLQNMETFIQRSESKASELQKAQDQQTEALSAQSRAQEAIQFDAQVSQALLAKTSVA
AANLQSVIDDAALKFKHVPGFGIGGSSAWSICAVLLIVLAAQNLKIAIALIFLILGHSVALIIFKFL*
Coding >Pro_DTO377G3_2|g6610.t1
ATGAGGGCAACCGATCGCTTCCAAGTGATTGCATATATCTTCCTGGCACTTACACACCTCGGTCGAGCAAGTGTC
TCCCAACACAATGTCCCAATTCTTGCAACCAGACCACCGGACATCGACACGGTCTCTTTCCTCAGTTCCCGGGCG
CAAGACCAAGACAGCATCTTCAACGAAGCCGTCAAAATCCTGGACTCGATGCAATCTTCACCCTCGTGCAACCGG
CTTGCAGCGACAAAACTAGTGAACTCGTGCCAAACATTCAGCGATGGCAAGGACGGCACGCAGACGGATAACCCA
GAGACTCTCGACGTTCTACGATCCGTCTATGCAGTACGCCTGGCATTGTGTGAGATCGACGGTGCTGGTACCCAA
ATGCCTCCCTCGTGCCTCCCTGTTACTGTCTCGCCACCTCCACAGAAGAATCGATTTGGCTTTGTGAGTCGACAC
AGAGGCCCCGACCCCATGTCGGATGAAGTTCCAAAAGAATTATTGGAGCAATGTCTGAGGACACTTGAGTCACGA
CCCCAGTGGTGGACCTCTTACAGCAACAGCCGACAGAATGCTCTTGTGATCTGCCATGCCTCGCGAATCGAGACG
GAGAAAGAGGAGCTTATTGAGCTTCAACGATCCATTGCCAAGAGCAGTCTCAAGCTCAACAATGGGCTTCAAGAG
GCGTTGCGAAATGCAATTGCACAGTCTGCGCAGCAGCAATCATTCATACATGCTCTTCAGTCTCTGCAAGGGAAG
ATCGTGACCGATATGGAAGCGACAGACTCTGTGTTCAAACGAACATTCGGCAAATTCCTTCGAGAAATCGAAGCT
GGAATCTGGTCGCTGCAAGATTCTATATCTGAGGCTTTGTCGAATGTGCGGGCTGGAACTGGGGTCCTCGAAGGG
GATATCCGGAACGTATCTACTCAAGTTGGAGCACTTCAACAGGCTCTACGGAGTGCACATCAAGATGCAATGACT
AGAAGCCGAGAGACGTTGCTAGCTCAAGAAACCAATGTTGTCGCCCAGAAGAATCTCGCATCATCTTTACACCTG
TCGCTCGAGTCACTTCTGGACTCAGACATGGACAAACTGTACCAAGGCATGCAGAGATTCGATGCTGCTATGGAA
TGGTTGGCCAGCCGGATGAACATGATTCTTGAGCAAGAAACCAGGATGACAGAGCGACTTCAAAACATGGAAACC
TTTATACAAAGATCCGAATCGAAGGCAAGCGAGCTACAAAAGGCGCAGGACCAACAAACAGAAGCACTATCTGCC
CAATCGCGGGCCCAGGAGGCCATTCAATTCGATGCGCAAGTGTCGCAAGCTTTGCTGGCCAAAACTAGTGTTGCT
GCTGCCAATTTACAATCCGTCATCGACGATGCAGCGTTAAAGTTCAAGCATGTCCCGGGTTTCGGCATTGGGGGA
TCCTCGGCATGGTCTATCTGCGCCGTCCTACTCATCGTCCTTGCCGCCCAGAACCTTAAGATTGCAATTGCTTTA
ATTTTTCTCATTTTGGGCCATTCTGTTGCCCTTATTATCTTCAAATTTCTCTAG
Transcript >Pro_DTO377G3_2|g6610.t1
ATGAGGGCAACCGATCGCTTCCAAGTGATTGCATATATCTTCCTGGCACTTACACACCTCGGTCGAGCAAGTGTC
TCCCAACACAATGTCCCAATTCTTGCAACCAGACCACCGGACATCGACACGGTCTCTTTCCTCAGTTCCCGGGCG
CAAGACCAAGACAGCATCTTCAACGAAGCCGTCAAAATCCTGGACTCGATGCAATCTTCACCCTCGTGCAACCGG
CTTGCAGCGACAAAACTAGTGAACTCGTGCCAAACATTCAGCGATGGCAAGGACGGCACGCAGACGGATAACCCA
GAGACTCTCGACGTTCTACGATCCGTCTATGCAGTACGCCTGGCATTGTGTGAGATCGACGGTGCTGGTACCCAA
ATGCCTCCCTCGTGCCTCCCTGTTACTGTCTCGCCACCTCCACAGAAGAATCGATTTGGCTTTGTGAGTCGACAC
AGAGGCCCCGACCCCATGTCGGATGAAGTTCCAAAAGAATTATTGGAGCAATGTCTGAGGACACTTGAGTCACGA
CCCCAGTGGTGGACCTCTTACAGCAACAGCCGACAGAATGCTCTTGTGATCTGCCATGCCTCGCGAATCGAGACG
GAGAAAGAGGAGCTTATTGAGCTTCAACGATCCATTGCCAAGAGCAGTCTCAAGCTCAACAATGGGCTTCAAGAG
GCGTTGCGAAATGCAATTGCACAGTCTGCGCAGCAGCAATCATTCATACATGCTCTTCAGTCTCTGCAAGGGAAG
ATCGTGACCGATATGGAAGCGACAGACTCTGTGTTCAAACGAACATTCGGCAAATTCCTTCGAGAAATCGAAGCT
GGAATCTGGTCGCTGCAAGATTCTATATCTGAGGCTTTGTCGAATGTGCGGGCTGGAACTGGGGTCCTCGAAGGG
GATATCCGGAACGTATCTACTCAAGTTGGAGCACTTCAACAGGCTCTACGGAGTGCACATCAAGATGCAATGACT
AGAAGCCGAGAGACGTTGCTAGCTCAAGAAACCAATGTTGTCGCCCAGAAGAATCTCGCATCATCTTTACACCTG
TCGCTCGAGTCACTTCTGGACTCAGACATGGACAAACTGTACCAAGGCATGCAGAGATTCGATGCTGCTATGGAA
TGGTTGGCCAGCCGGATGAACATGATTCTTGAGCAAGAAACCAGGATGACAGAGCGACTTCAAAACATGGAAACC
TTTATACAAAGATCCGAATCGAAGGCAAGCGAGCTACAAAAGGCGCAGGACCAACAAACAGAAGCACTATCTGCC
CAATCGCGGGCCCAGGAGGCCATTCAATTCGATGCGCAAGTGTCGCAAGCTTTGCTGGCCAAAACTAGTGTTGCT
GCTGCCAATTTACAATCCGTCATCGACGATGCAGCGTTAAAGTTCAAGCATGTCCCGGGTTTCGGCATTGGGGGA
TCCTCGGCATGGTCTATCTGCGCCGTCCTACTCATCGTCCTTGCCGCCCAGAACCTTAAGATTGCAATTGCTTTA
ATTTTTCTCATTTTGGGCCATTCTGTTGCCCTTATTATCTTCAAATTTCTCTAG
Gene >Pro_DTO377G3_2|g6610.t1
ATGAGGGCAACCGATCGCTTCCAAGTGATTGCATATATCTTCCTGGCACTTACACACCTCGGTCGAGCAAGTGTC
TCCCAACACAGTAAGCCACTCAGATACGTCTCAAATCATTTTACTGACATAAGAAGATGTCCCAATTCTTGCAAC
CAGACCACCGGACATCGACACGGTCTCTTTCCTCAGTTCCCGGGCGCAAGACCAAGACAGCATCTTCAACGAAGC
CGTCAAAATCCTGGACTCGATGCAATCTTCACCCTCGTGCAACCGGCTTGCAGCGACAAAACTAGTGAACTCGTG
CCAAACATTCAGCGATGGCAAGGACGGCACGCAGACGGATAACCCAGAGACTCTCGACGTTCTACGATCCGTCTA
TGCAGTACGCCTGGCATTGTGTGAGATCGACGGTGCTGGTACCCAAATGCCTCCCTCGTGCCTCCCTGTTACTGT
CTCGCCACCTCCACAGAAGAATCGATTTGGCTTTGTGAGTCGACACAGAGGCCCCGACCCCATGTCGGATGAAGT
TCCAAAAGAATTATTGGAGCAATGTCTGAGGACACTTGAGTCACGACCCCAGTGGTGGACCTCTTACAGCAACAG
CCGACAGAATGCTCTTGTGATCTGCCATGCCTCGCGAATCGAGACGGAGAAAGAGGAGCTTATTGAGCTTCAACG
ATCCATTGCCAAGAGCAGTCTCAAGCTCAACAATGGGCTTCAAGAGGCGTTGCGAAATGCAATTGCACAGTCTGC
GCAGCAGCAATCATTCATACATGCTCTTCAGTCTCTGCAAGGGAAGATCGTGACCGATATGGAAGCGACAGACTC
TGTGTTCAAACGAACATTCGGCAAATTCCTTCGAGAAATCGAAGCTGGAATCTGGTCGCTGCAAGATTCTATATC
TGAGGCTTTGTCGAATGTGCGGGCTGGAACTGGGGTCCTCGAAGGGGTACAATTCGAGCAGCTGAATGAGTTGAA
ACATGTACTAAAATTTCAACCAGGATATCCGGAACGTATCTACTCAAGTTGGAGCACTTCAACAGGCTCTACGGA
GTGCACATCAAGATGCAATGACTAGAAGCCGAGAGACGTTGCTAGCTCAAGAAACCAATGTTGTCGCCCAGAAGA
ATCTCGCATCATCTTTACACCTGTCGCTCGAGTCACTTCTGGACTCAGACATGGACAAACTGTACCAAGGCATGC
AGAGATTCGATGCTGCTATGGTGTGTGAAATATACATTTACCATGTAGTGACACTATGAGACTAATCTCTTGCCC
CTTTTTGTAGGAATGGTTGGCCAGCCGGATGAACATGATTCTTGAGCAAGAAACCAGGATGACAGAGGTACGAGT
ACATTCCTACATACCGGCTTTCTCACTGACTTTGAAAGCGACTTCAAAACATGGAAACCTTTATACAAAGATCCG
AATCGAAGGCAAGCGAGCTACAAAAGGCGCAGGACCAACAAACAGAAGCACTATCTGCCCAATCGCGGGCCCAGG
AGGCCATTCAATTCGATGCGCAAGTGTCGCAAGCTTTGCTGGCCAAAACTAGTGTTGCTGCTGCCAATTTACAAT
CCGTCATCGACGATGCAGCGTTAAAGTTCAAGCATGTCCCGGGTTTCGGCATTGGGGGATCCTCGGCATGGTCTA
TCTGCGCCGTCCTACTCATCGTCCTTGCCGCCCAGAACCTTAAGATTGCAATTGCTTTAATTTTTCTCATTTTGG
GTAGGTGTGTTCTTCATGATCAAGAGTGATTGGTGCTAATATAAGGAGGATTAGGCCATTCTGTTGCCCTTATTA
TCTTCAAATTTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail