Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6595.t1
Gene name
Locationscaffold_18:15836..18325
Strand-
Gene length (bp)2489
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 9.2E-41 31 211
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 3.1E-22 439 592
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 1.2E-07 235 338

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901681 sulfur compound binding No
GO:0050997 quaternary ammonium group binding No
GO:0019842 vitamin binding No
GO:0046872 metal ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 33.53 19.37 47.70
5d_25C Five days - 25 degrees Celsius 24.14 13.07 35.20
7d_25C Seven days - 25 degrees Celsius 23.56 12.35 34.76
10d_25C Ten days - 25 degrees Celsius 11.01 4.80 17.22
7d_15C Seven days - 15 degrees Celsius 16.55 7.42 25.68
7d_30C Seven days - 30 degrees Celsius 36.66 20.74 52.58

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.202164 no
3d_25C 7d_25C 0.168081 no
3d_25C 7d_15C 0.006000 yes
3d_25C 7d_30C 0.782278 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.952800 no
5d_25C 7d_15C 0.196290 no
5d_25C 7d_30C 0.084264 no
5d_25C 10d_25C 0.005235 yes
7d_25C 7d_15C 0.237706 no
7d_25C 7d_30C 0.069866 no
7d_25C 10d_25C 0.007779 yes
7d_15C 7d_30C 0.001278 yes
7d_15C 10d_25C 0.212879 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6595.t1
MKSTTTVPQKRKKEDSDDEDDIVKDGSLTSAADNFFEALFEAGITYCFVNLGSDHPAMLEAMIKAKQENKPNFPR
IITCPSELVALSAALGYAQATGVPQCVIVHVDCGTLAMGQSIHNASVSRVPVLCFAGLSPFTQNGELLGSRTEFI
HWLQDVPDQAAIVRQYCRYTGEIKTGRNIKQMVSRALQFATSDPKGPAYLMAAREVLEERVGNESLDGEILSSIT
PSALPEQEVELIAKSLMSAKRPLVITSYLGRNLKAPALLAELCDKLPITVVEMVGSDVCLRSDHEAYRGVTVTTH
PEVLQADVILILDCDVPWIPTAGKPRSGARVFHLDVDPLKQQMPLFSINATRKLKVGCGIALGQINAFLDKQDID
RAKYTLEFEERSTNYKTWRETLQALESPSKDGVVSVPYLASRLRKSLPQNTIYVLEAVTNAGHLIHHLNLTKPGS
LIASGAGGLGWGGGAALGVKLGKPGSFICAIVGDGVYLFSQMESVYWIARRYNIPFLLVVLNNGGWNAPKVSALL
VHKDGLSSKSNRRDLNISFDPSPDYPGIAAAAGKAWGATVTTRSELDPAIKQATEVVQSGKCAVVEVSVPSMWKE
N*
Coding >Pro_DTO377G3_2|g6595.t1
ATGAAGTCGACAACTACAGTACCCCAGAAACGAAAGAAGGAAGACAGCGATGATGAGGATGATATTGTCAAAGAT
GGCAGCCTCACATCCGCTGCTGACAATTTCTTCGAGGCACTGTTTGAGGCCGGTATCACATACTGCTTCGTCAAC
CTAGGGAGCGACCATCCCGCGATGTTGGAAGCAATGATCAAGGCTAAGCAAGAAAACAAACCCAATTTTCCGAGA
ATCATTACCTGCCCTTCTGAGCTAGTTGCCCTATCAGCTGCACTGGGATATGCTCAAGCTACAGGGGTTCCGCAA
TGCGTAATTGTGCATGTCGACTGCGGCACTCTTGCTATGGGACAGTCCATACATAATGCCTCCGTCAGCAGAGTT
CCTGTTTTGTGCTTTGCTGGTTTGAGCCCTTTTACTCAGAATGGCGAGTTGTTGGGTTCCAGAACTGAGTTCATC
CATTGGCTACAAGACGTACCTGATCAAGCAGCGATTGTTCGACAATACTGCAGATACACGGGTGAAATAAAGACC
GGACGCAATATCAAACAAATGGTCTCGCGAGCTTTGCAGTTTGCTACATCTGATCCCAAAGGTCCGGCATATCTA
ATGGCTGCGAGAGAGGTACTCGAGGAACGTGTGGGAAATGAATCTCTAGACGGTGAAATTCTCAGTTCGATCACC
CCAAGTGCATTGCCAGAGCAAGAGGTAGAATTGATTGCCAAGTCGCTGATGAGCGCAAAGCGACCGCTTGTCATT
ACAAGTTATCTTGGTCGGAATCTCAAAGCGCCAGCCCTCTTAGCCGAACTTTGTGATAAACTTCCAATTACCGTC
GTGGAGATGGTCGGCTCTGACGTTTGCCTCCGGAGTGACCACGAAGCATATCGCGGCGTTACCGTCACTACTCAT
CCGGAAGTTCTTCAAGCTGATGTTATTCTTATTCTTGATTGTGATGTGCCCTGGATTCCTACTGCTGGAAAGCCT
CGGAGTGGGGCAAGGGTATTCCATCTAGATGTCGATCCGTTGAAGCAACAGATGCCACTCTTTTCAATCAATGCC
ACTCGCAAGCTCAAGGTTGGCTGTGGAATTGCGCTTGGGCAAATCAATGCCTTCTTGGATAAACAGGATATCGAC
CGGGCTAAGTATACCCTGGAGTTTGAGGAGCGGTCAACTAACTACAAAACCTGGAGGGAAACTTTACAAGCACTT
GAATCACCGTCGAAAGATGGTGTAGTCAGTGTGCCATATCTGGCATCGAGACTGCGAAAGTCTCTCCCCCAAAAC
ACTATTTACGTTTTGGAGGCTGTAACCAATGCAGGACACCTCATCCACCATTTGAACTTGACTAAGCCGGGAAGT
CTGATTGCCAGCGGCGCAGGTGGTCTAGGATGGGGAGGTGGTGCAGCACTGGGCGTCAAGCTAGGCAAGCCCGGC
TCATTCATATGTGCAATCGTCGGCGACGGAGTCTATCTATTCTCGCAGATGGAAAGCGTATATTGGATCGCCAGA
CGCTACAATATCCCCTTCCTCCTCGTTGTGCTTAACAATGGCGGATGGAACGCACCAAAGGTGTCCGCACTTCTG
GTTCACAAGGACGGGTTATCATCGAAGTCGAATAGACGAGATCTCAATATCTCGTTCGACCCTTCTCCCGATTAC
CCCGGTATCGCTGCTGCAGCAGGTAAGGCGTGGGGTGCGACAGTTACCACGCGAAGCGAGCTTGATCCTGCTATC
AAACAGGCAACAGAAGTTGTTCAAAGTGGGAAATGTGCTGTGGTTGAGGTTTCTGTTCCGTCTATGTGGAAAGAG
AACTAG
Transcript >Pro_DTO377G3_2|g6595.t1
ATGAAGTCGACAACTACAGTACCCCAGAAACGAAAGAAGGAAGACAGCGATGATGAGGATGATATTGTCAAAGAT
GGCAGCCTCACATCCGCTGCTGACAATTTCTTCGAGGCACTGTTTGAGGCCGGTATCACATACTGCTTCGTCAAC
CTAGGGAGCGACCATCCCGCGATGTTGGAAGCAATGATCAAGGCTAAGCAAGAAAACAAACCCAATTTTCCGAGA
ATCATTACCTGCCCTTCTGAGCTAGTTGCCCTATCAGCTGCACTGGGATATGCTCAAGCTACAGGGGTTCCGCAA
TGCGTAATTGTGCATGTCGACTGCGGCACTCTTGCTATGGGACAGTCCATACATAATGCCTCCGTCAGCAGAGTT
CCTGTTTTGTGCTTTGCTGGTTTGAGCCCTTTTACTCAGAATGGCGAGTTGTTGGGTTCCAGAACTGAGTTCATC
CATTGGCTACAAGACGTACCTGATCAAGCAGCGATTGTTCGACAATACTGCAGATACACGGGTGAAATAAAGACC
GGACGCAATATCAAACAAATGGTCTCGCGAGCTTTGCAGTTTGCTACATCTGATCCCAAAGGTCCGGCATATCTA
ATGGCTGCGAGAGAGGTACTCGAGGAACGTGTGGGAAATGAATCTCTAGACGGTGAAATTCTCAGTTCGATCACC
CCAAGTGCATTGCCAGAGCAAGAGGTAGAATTGATTGCCAAGTCGCTGATGAGCGCAAAGCGACCGCTTGTCATT
ACAAGTTATCTTGGTCGGAATCTCAAAGCGCCAGCCCTCTTAGCCGAACTTTGTGATAAACTTCCAATTACCGTC
GTGGAGATGGTCGGCTCTGACGTTTGCCTCCGGAGTGACCACGAAGCATATCGCGGCGTTACCGTCACTACTCAT
CCGGAAGTTCTTCAAGCTGATGTTATTCTTATTCTTGATTGTGATGTGCCCTGGATTCCTACTGCTGGAAAGCCT
CGGAGTGGGGCAAGGGTATTCCATCTAGATGTCGATCCGTTGAAGCAACAGATGCCACTCTTTTCAATCAATGCC
ACTCGCAAGCTCAAGGTTGGCTGTGGAATTGCGCTTGGGCAAATCAATGCCTTCTTGGATAAACAGGATATCGAC
CGGGCTAAGTATACCCTGGAGTTTGAGGAGCGGTCAACTAACTACAAAACCTGGAGGGAAACTTTACAAGCACTT
GAATCACCGTCGAAAGATGGTGTAGTCAGTGTGCCATATCTGGCATCGAGACTGCGAAAGTCTCTCCCCCAAAAC
ACTATTTACGTTTTGGAGGCTGTAACCAATGCAGGACACCTCATCCACCATTTGAACTTGACTAAGCCGGGAAGT
CTGATTGCCAGCGGCGCAGGTGGTCTAGGATGGGGAGGTGGTGCAGCACTGGGCGTCAAGCTAGGCAAGCCCGGC
TCATTCATATGTGCAATCGTCGGCGACGGAGTCTATCTATTCTCGCAGATGGAAAGCGTATATTGGATCGCCAGA
CGCTACAATATCCCCTTCCTCCTCGTTGTGCTTAACAATGGCGGATGGAACGCACCAAAGGTGTCCGCACTTCTG
GTTCACAAGGACGGGTTATCATCGAAGTCGAATAGACGAGATCTCAATATCTCGTTCGACCCTTCTCCCGATTAC
CCCGGTATCGCTGCTGCAGCAGGTAAGGCGTGGGGTGCGACAGTTACCACGCGAAGCGAGCTTGATCCTGCTATC
AAACAGGCAACAGAAGTTGTTCAAAGTGGGAAATGTGCTGTGGTTGAGGTTTCTGTTCCGTCTATGTGGAAAGAG
AACTAG
Gene >Pro_DTO377G3_2|g6595.t1
ATGAAGTCGACAACTACAGTACCCCAGAAACGAAAGAAGGAAGACAGCGATGATGAGGATGATATTGTCAAAGAT
GGCAGCCTCACATCCGCTGCTGACAATTTCTTCGAGGCACTGTGTATGTGATCGAAGCTTCACGCAGTCCATTGG
AAAGGCTAACCTTCTTTCCAGTTGAGGCCGGTATCACATACTGCTTCGTCAACCTGTTAGTGACTGTATTAGCCA
CTAATTCTATGTGTTCTGACCGGTCTGATAGAGGGAGCGACCATCCCGCGATGTTGGAAGCAATGATCAAGGCTA
AGCAAGGTGAGTACCGGATATGTTACCAGCAACCAGGGCTTATTTATGATAGAAAACAAACCCAATTTTCCGAGA
ATCATTACCTGCCCTTCTGAGCTAGTTGCCCTATCAGCTGCACTGGGATATGCTCAAGCTACAGGGGTTCCGGTA
GATGACTACGCCCATCATATCAATTCTTTCGCTAACTTCTTGCAAGCAATGCGTAATTGTGCATGTCGACTGCGG
CACTCTTGCTATGGGACAGTCCATACATAATGCCTCCGTCAGCAGAGTTCCTGTTTTGTGCTTTGCTGGTTTGAG
CCCTTTTACTCAGAATGGCGAGTTGTTGGGTTCCAGAACTGAGTTAGCAAGCCAAACGAAGTAGGTTTACATGGA
GCCAGCTGACTGATACTGAAGTACAGGTTCATCCATTGGCTACAAGACGTACCTGATCAAGCAGCGATTGTTCGA
CAATACTGCAGATACACGGGTGAAATAAAGACCGGACGCAATATCAAACAAATGGTCTCGCGAGCTTTGCAGTTT
GCTACATCTGATCCCAAAGGTCCGGCATATCTAATGGCTGCGAGAGAGGTACTCGAGGAAGTAAGTATTCGAAGT
TATCGCAATAAGCCAAAATTGTCTCTAACCATATCTTATGCAGCGTGTGGGAAATGAATCTCTAGACGGTGAAAT
TCTCAGTTCGATCACCCCAAGTGCATTGCCAGAGCAAGGTAGGGTGATAATTTGAGATTTGAGATTTCATATCGC
TGACAGCAATAGAGGTAGAATTGATTGCCAAGTCGCTGATGAGCGCAAAGCGACCGCTTGTCATTACAAGTTATC
TTGGTCGGAATCTCAAAGCGCCAGCCCTCTTAGCCGAACTTTGTGATAAACTTCCAATTACCGTCGTGGAGATGG
TCGGCTCTGACGTTTGCCTCCGGAGTGACCACGAAGCATATCGCGGCGTTACCGTCACTACTCATCCGGAAGTTC
TTCAAGCTGATGTTATTCTTATTCTTGATTGTGATGTGCCCTGGATTCCTACTGCTGGAAAGCCTCGGAGTGGTA
AGAATGTCCAAAAAACCATGTTTCAGTGCTGTTCTGACACACACTGCAGGGGCAAGGGTATTCCATCTAGATGTC
GATCCGTTGAAGCAACAGATGCCACGTAAGTTCATATATCGACCGTATTGCTGACTTTTCTCTGCTTTTTTATTA
ACGATTACATATCAGTCTTTTCAATCAATGCCACTCGCAAGCTCAAGGTTGGCTGTGGAATTGCGCTTGGGCAAA
TCAATGCCTTCTTGGATAAACAGGATATCGACCGGGCTAAGTATACCCTGGAGTTTGAGGAGCGGTCAACTAACT
ACAAAACCTGGAGGGAAACTTTACAAGCACTTGAATCACCGTCGAAAGATGGTGTAGTCAGTGTGCCATATCTGG
CATCGAGACTGCGAAAGTCTCTCCCCCAAAACACTATTTACGTTTTGGAGGCTGTAACCAATGCAGGACACCTCA
TCCACCATTTGAACTTGACTAAGGTATGTATTCATGCCAATGTGCTGATTCTATGCTAATCAAATTCCAGCCGGG
AAGTCTGATTGCCAGCGGCGCAGGTGGTCTAGGATGGGGAGGTGGTGCAGCACTGGGCGTCAAGCTAGGCAAGCC
CGGCTCATTCATATGTGCAATGTAAGTGTTCACCAGCGCGGGAGCTCTTCCACAATATCTAATAAGCATCAGCGT
CGGCGACGGAGTCTATCTATTCTCGCAGATGGAAAGCGTATATTGGATCGCCAGACGCTACAATATCCCCTTCCT
CCTCGTTGTGCTTAACAATGGCGGATGGAACGCACCAAAGGTGTCCGCACTTCTGGTTCACAAGGACGGGTTATC
ATCGAAGTCGAATAGACGAGGTCAGCCAGATCTAAACTAAATATCTTGTGCATAGTAGCTGATCTAGTACAGATC
TCAATATCTCGTTCGACCCTTCTCCCGATTACCCCGGTATCGCTGCTGCAGCAGGTAAGGCGTGGGGTGCGACAG
TTACCACGCGAAGCGAGCTTGATCCTGCTATCAAACAGGCAACAGAAGTTGTTCAAAGTGGGAAATGTGCTGTGG
TTGAGGTTTCGTGAGTGGGAATAGTGGCTCTTAAGTAACAACCGCTTACTTTCATCTATAGTGTTCCGTCTATGT
GGAAAGAGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail