Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6564.t1
Gene name
Locationscaffold_17:526553..531952
Strand+
Gene length (bp)5399
Transcript length (bp)3681
Coding sequence length (bp)3681
Protein length (aa) 1227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04424 MINDY_DUB MINDY deubiquitinase 2.7E-19 429 554
PF03442 CBM_X2 Carbohydrate binding domain X2 2.0E-16 1049 1118
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 2.8E-08 883 1035

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004843 thiol-dependent ubiquitin-specific protease activity Yes
GO:1990380 Lys48-specific deubiquitinase activity Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0019783 ubiquitin-like protein-specific protease activity No
GO:0008233 peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0101005 ubiquitinyl hydrolase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0036459 thiol-dependent ubiquitinyl hydrolase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6564.t1
MGLRKQPPPRLENISKSNVRSDARSSKSPNSASFHRPIRLNRFPSGDPIYSPDLNTSPAFDLMPLEEAQRSPVGS
PTSQPPSSWPDNNRRPEDGRSGQYNQYEGAYNEPANTNGHWVSPTLTAGQQLGAAENVWRSTTDGGRASTGELPV
QLQSNNPFLKPRPAEHTQDLLDRNEWGRDSHATSNSDALSQSEGYIPMTARLSLLDEPEQESPWTEAPRPQSNSQ
QRPVLGGHHLDDNSPWDSQQSAKVPVPQGVYLQGEQSNPYAPAVAVQPSGLSDWETYAGQQYKPPSNSGRLGSDA
GINTPSVALSNRTSATSHELIDFGELSATGNSVGETRSPAASTAYSEPAANGARSLSEKQDFAAPVIQQLQQPQA
SPILSPAEAARQKEQRSETYTIRHIRWTDQSGQLLESPILVQNQNGPCPLLALINALVLRANPNAHPPIVRALST
REQISLGLLIEAMFEELTTCLGPDEEFPDIEALTQFLTMLHTGMNVNPRLTMNSTEGFGTFLETSDLGLYSTFGI
PLIHGWLASWSSPTHAAMSRTAQYYEDIQMLPFRRHEFEERVARGEALEPAEENIMADIQTIQRFVEIENATQLS
PFGLTQLSTKLTPGSVSILFRNDHFSTLYKHPQSHQLYTLVTDAGYAGHAEVVWESLVDVTGFNTEYYSGDFRPV
GAGPSAPSGPDPAVLQASNEPATHSPEANEGSKSPELTQEQSDADYAYALSLQFQEEERRENARNEQARDRRTSA
PSNSSNRPLPSPRLSNVPNRPLPSPRLSNVPNRSSSIANTIGSRPSPQPQHGPDPEDPNAPPPPYEQAAASGPRC
SPPDIRPYGRAAGNQYPGNRNPRNRTSQSSHRPRPPRVSNVVDMIVARGIYAIVDVHHVAFEPINEPPCNTAVDV
TESNKLNNIFLQAINDAGGFNSQRIVNLVGGGEDSVKTADWFVAPSGFWNPYAIQFHYYSPRERPFGARGSDSDK
TTVQSDFQLLRNAFPDVPLLLGEYDASPTNTEPAARYKYLDFLIKTAASLDISCVLWNNGLDHLDRTAGVWRDSQ
TLPFIFNGNTLSSISDSTCSALSLGTDYSVSGANIIFTASYLSKHLSSTTTPGINATLTLRFSGGDSSPAVQIVQ
WKAPTLSSTSAVASTVSGSALSIPITWGGLSTVAALKALTKSGTYLVDDWTVSLSPIQQARVTYSNQYNWDDSNV
ILTSSAISCHLCWPIDRVHLRVFPTG*
Coding >Pro_DTO377G3_2|g6564.t1
ATGGGCCTGCGAAAACAGCCCCCACCGCGTCTGGAGAACATTAGCAAGTCAAATGTTCGATCGGACGCACGCTCA
TCCAAGTCACCCAACTCTGCTTCCTTCCATCGCCCGATTCGTTTAAACCGATTTCCTTCTGGGGACCCTATCTAC
TCTCCCGACCTCAATACTTCACCTGCGTTTGACCTGATGCCACTTGAGGAAGCACAGCGGTCGCCTGTGGGGTCT
CCCACCAGCCAACCCCCGAGCTCATGGCCAGACAATAACAGAAGACCGGAAGACGGCCGCTCCGGTCAGTATAAT
CAGTATGAGGGAGCATACAACGAACCTGCAAATACCAACGGACACTGGGTTTCCCCGACATTGACGGCAGGTCAA
CAACTAGGAGCGGCCGAGAATGTGTGGCGGTCAACGACTGATGGCGGTCGTGCTTCGACTGGAGAGCTACCGGTA
CAGCTGCAGTCGAATAACCCATTCTTGAAGCCTAGGCCGGCAGAGCATACTCAAGATCTCTTGGATCGCAATGAG
TGGGGACGTGATTCACATGCGACTTCAAACAGTGACGCATTGAGCCAATCCGAAGGGTATATTCCGATGACTGCG
CGGCTCTCTCTTTTAGATGAGCCCGAACAAGAATCCCCATGGACCGAGGCTCCTCGTCCTCAATCCAATTCCCAG
CAACGCCCTGTATTAGGCGGTCACCACCTCGATGATAACTCACCGTGGGACTCTCAACAGTCCGCCAAGGTTCCG
GTTCCCCAGGGTGTCTACCTACAAGGAGAGCAGTCTAATCCATATGCCCCAGCGGTTGCGGTGCAGCCGTCTGGC
CTTTCTGATTGGGAAACCTATGCCGGCCAACAATATAAGCCTCCATCCAATTCAGGGAGACTTGGATCGGATGCT
GGAATCAATACTCCATCTGTTGCTCTTTCTAATCGAACCTCTGCTACCTCTCATGAACTAATTGATTTTGGTGAA
TTGAGCGCCACTGGGAATTCGGTGGGCGAGACCAGGTCTCCTGCTGCATCTACGGCGTACTCAGAACCTGCCGCG
AACGGAGCAAGATCATTATCAGAAAAGCAAGACTTCGCAGCTCCCGTGATACAACAACTACAACAACCCCAAGCA
AGCCCTATACTGTCTCCCGCAGAAGCTGCACGACAAAAAGAGCAAAGATCAGAAACATATACTATTCGACACATC
CGATGGACCGATCAGAGTGGTCAACTGCTGGAGTCCCCGATTTTGGTCCAAAATCAAAACGGACCTTGTCCTCTG
CTAGCCCTTATAAATGCATTAGTGCTACGAGCGAACCCTAACGCTCACCCACCAATCGTTAGAGCTCTGTCAACT
CGCGAGCAAATCTCTCTAGGTTTGCTAATCGAGGCGATGTTTGAAGAGCTGACAACATGCCTGGGCCCTGATGAG
GAGTTCCCAGACATCGAGGCCCTCACTCAATTCCTGACAATGCTGCACACGGGTATGAATGTCAATCCACGTTTG
ACAATGAATTCTACTGAAGGATTTGGCACTTTCCTCGAAACCAGCGACCTCGGACTGTATAGCACGTTTGGTATA
CCATTGATCCATGGCTGGCTAGCCTCATGGTCCAGTCCTACCCATGCTGCGATGTCACGCACTGCCCAGTATTAC
GAGGATATTCAAATGCTTCCCTTCCGCAGACACGAGTTTGAGGAACGGGTGGCGCGGGGCGAGGCACTTGAACCT
GCGGAAGAGAATATCATGGCGGATATCCAAACCATCCAGCGATTTGTGGAAATTGAGAATGCGACACAATTGAGC
CCATTTGGCCTGACACAGCTCTCAACTAAGCTTACGCCCGGATCTGTCTCCATTCTTTTCCGCAACGACCATTTC
TCGACATTGTATAAACACCCGCAATCCCACCAACTCTACACTTTGGTTACCGATGCTGGCTATGCGGGCCATGCC
GAGGTGGTTTGGGAATCTCTAGTCGATGTGACAGGATTCAACACAGAATATTACTCAGGCGATTTTCGACCTGTA
GGCGCTGGTCCTTCAGCTCCATCTGGCCCTGATCCCGCGGTCCTCCAAGCCTCTAATGAGCCAGCCACTCATTCT
CCAGAGGCAAACGAAGGATCGAAATCCCCTGAGCTGACTCAAGAACAGAGTGATGCCGACTATGCATACGCGCTG
TCACTTCAGTTCCAAGAAGAAGAGCGACGCGAAAATGCTAGGAATGAGCAGGCTCGTGATCGTCGCACATCTGCG
CCGAGTAATTCTTCCAATCGGCCATTGCCTTCGCCTCGCTTGAGCAATGTGCCTAATCGACCATTGCCCTCGCCT
CGTTTGAGCAATGTACCCAATCGATCTTCGAGCATTGCCAATACGATTGGTTCTCGGCCTAGTCCTCAGCCACAA
CATGGACCCGACCCTGAGGACCCAAATGCACCCCCTCCTCCATATGAACAAGCTGCTGCTAGCGGGCCGCGTTGT
TCGCCTCCTGACATAAGGCCATATGGCCGTGCCGCAGGAAATCAGTACCCTGGTAACCGGAATCCGCGGAATCGA
ACCTCGCAGTCTTCTCACCGACCACGCCCGCCTCGAGTCTCTAATGTGGTTGATATGATTGTGGCTCGTGGAATC
TACGCTATCGTTGATGTGCATCATGTTGCCTTTGAGCCTATCAATGAGCCTCCTTGCAATACTGCGGTCGACGTT
ACCGAGTCCAACAAACTGAACAACATCTTTCTCCAGGCTATCAATGATGCTGGTGGGTTCAACTCGCAGAGAATT
GTTAATCTAGTCGGAGGTGGTGAGGATAGCGTCAAGACTGCAGACTGGTTTGTAGCACCCTCTGGATTTTGGAAT
CCATATGCTATTCAGTTCCACTACTACAGTCCCCGGGAAAGACCATTTGGGGCTCGGGGCTCTGACAGTGACAAG
ACTACTGTGCAGTCTGACTTCCAGCTGCTGCGCAACGCTTTCCCTGATGTACCTCTCCTTTTGGGTGAATACGAT
GCTTCACCCACCAACACCGAACCCGCTGCCCGATATAAGTACCTTGACTTCTTGATCAAGACTGCAGCCAGTCTC
GATATCTCCTGCGTGTTGTGGAATAACGGATTGGACCACTTGGATCGAACCGCAGGAGTCTGGCGTGACTCACAA
ACTCTTCCATTCATCTTCAACGGTAACACCCTCTCGTCAATCAGTGACTCCACTTGCTCGGCATTGTCGTTGGGA
ACAGACTATTCTGTTTCGGGTGCAAATATAATATTCACAGCTTCGTACTTATCCAAGCATCTTTCATCTACGACA
ACACCGGGTATTAATGCCACTCTAACTCTGAGATTCTCGGGGGGCGATTCGTCCCCTGCTGTCCAAATTGTTCAA
TGGAAAGCCCCAACTCTGTCGTCCACATCGGCGGTGGCTTCGACTGTCTCTGGCTCTGCCCTATCAATTCCAATC
ACATGGGGCGGACTATCAACCGTCGCTGCATTAAAGGCCTTGACCAAGAGTGGAACATACCTGGTCGATGACTGG
ACGGTATCACTGAGCCCTATCCAGCAAGCGAGAGTTACCTACAGCAACCAGTATAACTGGGATGACTCCAATGTA
ATCCTCACTTCATCTGCTATTAGCTGTCATCTCTGCTGGCCAATCGACCGTGTTCACCTTCGAGTTTTTCCCACG
GGATAA
Transcript >Pro_DTO377G3_2|g6564.t1
ATGGGCCTGCGAAAACAGCCCCCACCGCGTCTGGAGAACATTAGCAAGTCAAATGTTCGATCGGACGCACGCTCA
TCCAAGTCACCCAACTCTGCTTCCTTCCATCGCCCGATTCGTTTAAACCGATTTCCTTCTGGGGACCCTATCTAC
TCTCCCGACCTCAATACTTCACCTGCGTTTGACCTGATGCCACTTGAGGAAGCACAGCGGTCGCCTGTGGGGTCT
CCCACCAGCCAACCCCCGAGCTCATGGCCAGACAATAACAGAAGACCGGAAGACGGCCGCTCCGGTCAGTATAAT
CAGTATGAGGGAGCATACAACGAACCTGCAAATACCAACGGACACTGGGTTTCCCCGACATTGACGGCAGGTCAA
CAACTAGGAGCGGCCGAGAATGTGTGGCGGTCAACGACTGATGGCGGTCGTGCTTCGACTGGAGAGCTACCGGTA
CAGCTGCAGTCGAATAACCCATTCTTGAAGCCTAGGCCGGCAGAGCATACTCAAGATCTCTTGGATCGCAATGAG
TGGGGACGTGATTCACATGCGACTTCAAACAGTGACGCATTGAGCCAATCCGAAGGGTATATTCCGATGACTGCG
CGGCTCTCTCTTTTAGATGAGCCCGAACAAGAATCCCCATGGACCGAGGCTCCTCGTCCTCAATCCAATTCCCAG
CAACGCCCTGTATTAGGCGGTCACCACCTCGATGATAACTCACCGTGGGACTCTCAACAGTCCGCCAAGGTTCCG
GTTCCCCAGGGTGTCTACCTACAAGGAGAGCAGTCTAATCCATATGCCCCAGCGGTTGCGGTGCAGCCGTCTGGC
CTTTCTGATTGGGAAACCTATGCCGGCCAACAATATAAGCCTCCATCCAATTCAGGGAGACTTGGATCGGATGCT
GGAATCAATACTCCATCTGTTGCTCTTTCTAATCGAACCTCTGCTACCTCTCATGAACTAATTGATTTTGGTGAA
TTGAGCGCCACTGGGAATTCGGTGGGCGAGACCAGGTCTCCTGCTGCATCTACGGCGTACTCAGAACCTGCCGCG
AACGGAGCAAGATCATTATCAGAAAAGCAAGACTTCGCAGCTCCCGTGATACAACAACTACAACAACCCCAAGCA
AGCCCTATACTGTCTCCCGCAGAAGCTGCACGACAAAAAGAGCAAAGATCAGAAACATATACTATTCGACACATC
CGATGGACCGATCAGAGTGGTCAACTGCTGGAGTCCCCGATTTTGGTCCAAAATCAAAACGGACCTTGTCCTCTG
CTAGCCCTTATAAATGCATTAGTGCTACGAGCGAACCCTAACGCTCACCCACCAATCGTTAGAGCTCTGTCAACT
CGCGAGCAAATCTCTCTAGGTTTGCTAATCGAGGCGATGTTTGAAGAGCTGACAACATGCCTGGGCCCTGATGAG
GAGTTCCCAGACATCGAGGCCCTCACTCAATTCCTGACAATGCTGCACACGGGTATGAATGTCAATCCACGTTTG
ACAATGAATTCTACTGAAGGATTTGGCACTTTCCTCGAAACCAGCGACCTCGGACTGTATAGCACGTTTGGTATA
CCATTGATCCATGGCTGGCTAGCCTCATGGTCCAGTCCTACCCATGCTGCGATGTCACGCACTGCCCAGTATTAC
GAGGATATTCAAATGCTTCCCTTCCGCAGACACGAGTTTGAGGAACGGGTGGCGCGGGGCGAGGCACTTGAACCT
GCGGAAGAGAATATCATGGCGGATATCCAAACCATCCAGCGATTTGTGGAAATTGAGAATGCGACACAATTGAGC
CCATTTGGCCTGACACAGCTCTCAACTAAGCTTACGCCCGGATCTGTCTCCATTCTTTTCCGCAACGACCATTTC
TCGACATTGTATAAACACCCGCAATCCCACCAACTCTACACTTTGGTTACCGATGCTGGCTATGCGGGCCATGCC
GAGGTGGTTTGGGAATCTCTAGTCGATGTGACAGGATTCAACACAGAATATTACTCAGGCGATTTTCGACCTGTA
GGCGCTGGTCCTTCAGCTCCATCTGGCCCTGATCCCGCGGTCCTCCAAGCCTCTAATGAGCCAGCCACTCATTCT
CCAGAGGCAAACGAAGGATCGAAATCCCCTGAGCTGACTCAAGAACAGAGTGATGCCGACTATGCATACGCGCTG
TCACTTCAGTTCCAAGAAGAAGAGCGACGCGAAAATGCTAGGAATGAGCAGGCTCGTGATCGTCGCACATCTGCG
CCGAGTAATTCTTCCAATCGGCCATTGCCTTCGCCTCGCTTGAGCAATGTGCCTAATCGACCATTGCCCTCGCCT
CGTTTGAGCAATGTACCCAATCGATCTTCGAGCATTGCCAATACGATTGGTTCTCGGCCTAGTCCTCAGCCACAA
CATGGACCCGACCCTGAGGACCCAAATGCACCCCCTCCTCCATATGAACAAGCTGCTGCTAGCGGGCCGCGTTGT
TCGCCTCCTGACATAAGGCCATATGGCCGTGCCGCAGGAAATCAGTACCCTGGTAACCGGAATCCGCGGAATCGA
ACCTCGCAGTCTTCTCACCGACCACGCCCGCCTCGAGTCTCTAATGTGGTTGATATGATTGTGGCTCGTGGAATC
TACGCTATCGTTGATGTGCATCATGTTGCCTTTGAGCCTATCAATGAGCCTCCTTGCAATACTGCGGTCGACGTT
ACCGAGTCCAACAAACTGAACAACATCTTTCTCCAGGCTATCAATGATGCTGGTGGGTTCAACTCGCAGAGAATT
GTTAATCTAGTCGGAGGTGGTGAGGATAGCGTCAAGACTGCAGACTGGTTTGTAGCACCCTCTGGATTTTGGAAT
CCATATGCTATTCAGTTCCACTACTACAGTCCCCGGGAAAGACCATTTGGGGCTCGGGGCTCTGACAGTGACAAG
ACTACTGTGCAGTCTGACTTCCAGCTGCTGCGCAACGCTTTCCCTGATGTACCTCTCCTTTTGGGTGAATACGAT
GCTTCACCCACCAACACCGAACCCGCTGCCCGATATAAGTACCTTGACTTCTTGATCAAGACTGCAGCCAGTCTC
GATATCTCCTGCGTGTTGTGGAATAACGGATTGGACCACTTGGATCGAACCGCAGGAGTCTGGCGTGACTCACAA
ACTCTTCCATTCATCTTCAACGGTAACACCCTCTCGTCAATCAGTGACTCCACTTGCTCGGCATTGTCGTTGGGA
ACAGACTATTCTGTTTCGGGTGCAAATATAATATTCACAGCTTCGTACTTATCCAAGCATCTTTCATCTACGACA
ACACCGGGTATTAATGCCACTCTAACTCTGAGATTCTCGGGGGGCGATTCGTCCCCTGCTGTCCAAATTGTTCAA
TGGAAAGCCCCAACTCTGTCGTCCACATCGGCGGTGGCTTCGACTGTCTCTGGCTCTGCCCTATCAATTCCAATC
ACATGGGGCGGACTATCAACCGTCGCTGCATTAAAGGCCTTGACCAAGAGTGGAACATACCTGGTCGATGACTGG
ACGGTATCACTGAGCCCTATCCAGCAAGCGAGAGTTACCTACAGCAACCAGTATAACTGGGATGACTCCAATGTA
ATCCTCACTTCATCTGCTATTAGCTGTCATCTCTGCTGGCCAATCGACCGTGTTCACCTTCGAGTTTTTCCCACG
GGATAA
Gene >Pro_DTO377G3_2|g6564.t1
ATGGGCCTGCGAAAACAGCCCCCACCGCGTCTGGAGAACATTAGCAAGTCAAATGTTCGATCGGACGCACGCTCA
TCCAAGTCACCCAACTCTGCTTCCTTCCATCGCCCGATTCGTTTAAACCGATTTCCTTCTGGGGACCCTATCTAC
TCTCCCGACCTCAATACTTCACCTGCGTTTGACCTGATGCCACTTGAGGAAGCACAGCGGTCGCCTGTGGGGTCT
CCCACCAGCCAACCCCCGAGCTCATGGCCAGACAATAACAGAAGACCGGAAGACGGCCGCTCCGGTCAGTATAAT
CAGTATGAGGGAGCATACAACGAACCTGCAAATACCAACGGACACTGGGTTTCCCCGACATTGACGGCAGGTCAA
CAACTAGGAGCGGCCGAGAATGTGTGGCGGTCAACGACTGATGGCGGTCGTGCTTCGACTGGAGAGCTACCGGTA
CAGCTGCAGTCGAATAACCCATTCTTGAAGCCTAGGCCGGCAGAGCATACTCAAGATCTCTTGGATCGCAATGAG
TGGGGACGTGATTCACATGCGACTTCAAACAGTGACGCATTGAGCCAATGTATGGCATTAGTTCCTTCTGAAAGT
TCCCTCAAAATGATATTTGTTGCTAACAACTTGTAGCCGAAGGGTATATTCCGATGACTGCGCGGCTCTCTCTTT
TAGATGAGCCCGAACAAGAATCCCCATGGACCGAGGCTCCTCGTCCTCAATCCAATTCCCAGCAACGCCCTGTAT
TAGGCGGTCACCACCTCGATGATAACTCACCGTGGGACTCTCAACAGTCCGCCAAGGTTCCGGTTCCCCAGGGTG
TCTACCTACAAGGAGAGCAGTCTAATCCATATGCCCCAGCGGTTGCGGTGCAGCCGTCTGGCCTTTCTGATTGGG
AAACCTATGCCGGCCAACAATATAAGCCTCCATCCAATTCAGGGAGACTTGGATCGGATGCTGGAATCAATACTC
CATCTGTTGCTCTTTCTAATCGAACCTCTGCTACCTCTCATGAACTAATTGATTTTGGTGAATTGAGCGCCACTG
GGAATTCGGTGGGCGAGACCAGGTCTCCTGCTGCATCTACGGCGTACTCAGAACCTGCCGCGAACGGAGCAAGAT
CATTATCAGAAAAGCAAGACTTCGCAGCTCCCGTGATACAACAACTACAACAACCCCAAGCAAGCCCTATACTGT
CTCCCGCAGAAGCTGCACGACAAAAAGAGCAAAGATCAGAAACATATACTATTCGACACATCCGATGGACCGATC
AGAGTGGTCAACTGCTGGAGTCCCCGATTTTGGTCCAAAATCAAAACGGACCTTGTCCTCTGCTAGCCCTTATAA
ATGCATTAGTGCTACGAGCGAACCCTAACGCTCACCCACCAATCGTTAGAGCTCTGTCAACTCGCGAGCAAATCT
CTCTAGGTTTGCTAATCGAGGCGATGTTTGAAGAGCTGACAACATGCCTGGGCCCTGATGAGGAGTTCCCAGACA
TCGAGGCCCTCACTCAATTCCTGACAATGCTGCACACGGGTATGAATGTCAATCCACGTTTGACAATGGTGAGTA
CATGCGATGTATCTGTCAAATATCACTTATACTAACCTAATGTCAGAATTCTACTGAAGGATTTGGCACTTTCCT
CGAAACCAGCGACCTCGGACTGTATAGCACGTTTGGTATACCATTGATCCATGGCTGGCTAGCCTCATGGTCCAG
TCCTACCCATGCTGCGATGTCACGCACTGCCCAGTATTACGAGGATATTCAAATGCTTCCCTTCCGCAGACACGA
GTTTGAGGAACGGGTGGCGCGGGGCGAGGCACTTGAACCTGCGGAAGAGAATATCATGGCGGATATCCAAACCAT
CCAGCGATTTGTGGAAATTGAGAATGCGACACAATTGAGCCCATTTGGCCTGACACAGCTCTCAACTAAGCTTAC
GCCCGGATCTGTCTCCATTCTTTTCCGCAACGACCATTTCTCGACATTGTATAAACACCCGCAATCCCACCAACT
CTACACTTTGGTTACCGATGCTGGCTATGCGGGCCATGCCGAGGTGGTTTGGGAATCTCTAGTCGATGTGACAGG
ATTCAACACAGAATATTACTCAGGCGATTTTCGACCTGTAGGCGCTGGTCCTTCAGCTCCATCTGGCCCTGATCC
CGCGGTCCTCCAAGCCTCTAATGAGCCAGCCACTCATTCTCCAGAGGCAAACGAAGGATCGAAATCCCCTGAGCT
GACTCAAGAACAGAGTGATGCCGACTATGCATACGCGCTGTCACTTCAGTTCCAAGAAGAAGAGCGACGCGAAAA
TGCTAGGAATGAGCAGGCTCGTGATCGTCGCACATCTGCGCCGAGTAATTCTTCCAATCGGCCATTGCCTTCGCC
TCGCTTGAGCAATGTGCCTAATCGACCATTGCCCTCGCCTCGTTTGAGCAATGTACCCAATCGATCTTCGAGCAT
TGCCAATACGATTGGTTCTCGGCCTAGTCCTCAGCCACAACATGGACCCGACCCTGAGGACCCAAATGCACCCCC
TCCTCCATATGAACAAGCTGCTGCTAGCGGGCCGCGTTGTTCGCCTCCTGACATAAGGCCATATGGCCGTGCCGC
AGGAAATCAGTACCCTGGTAACCGGAATCCGCGGAATCGAACCTCGCAGTCTTCTCACCGACCACGCCCGCCTGT
ACGTGCAGGGGATCATAATATAGAAACAGAACGGAACAAAGAATGCATAGTGATGTGACCAATGTAAGATCTGGA
AATGATAAGAGGCGTTGATACTTGCTTTACGCCAATGCACTGGATGGATGAATATGATGCCTACAAATGATATAT
ACTATTGTAGAGAAAGAACATGTCTTTGATTGATTCGATTCCATATGGAACCTTAATTTCTTGCTCCTCGTTATC
CTCATTCTCCACGGCGTTATGGAAATTAACAAGGACCTTCTCCGTGCCTCTAACAGGAGCGGGGCTAATAAGCAT
ATATCAACAAAGTGACATGTGAGATAGCTACGTATGTTCGGACTTGTCACGGACTACACCTATGCCCGGAGGTTA
AGTAAATTAAAGGACTCACATGAGGAAGAGGTTTCTCATTGGAGGAGTCATTATCCAGATAGCCCTAGATCTTCC
CCCGGGAAAGACTAAAAAAGTGTGTATAAGCTATGTATTGCGATATATGCCGACCATATTGCCCTATAGCCTAAG
TCAAAGGCGATTTGGGACGCTCTTATGTCCTGAATGATACAACCCCGGTCCACCGGCCCGTTGACTAGGATCAGG
GCATACGTAGTATAAAGAATGCTGCTATGCTAAAATTGGCCTATAATCATCCTTCACGGTGCTGATTTCCTTGCG
AGCCATCAGGATCTGTATATTTCCTCTGACAGTAGCTCTTGCGATGCAGATTCTTCTTTCTAGTGCTCTAGCCCT
CGTTGGGATGGCCCAGGCCACTACTGTTTGCAGTGGAACATTTAGCACAATCTCAGCTGCCGAGTTTGTGTCTAA
CCTGCGTCCCGGTTGGAATCTGGGAAATAATCTTGATGCTGTCCCCGATGAGGGATCTTGGAATAATATGCCAGT
TGTGGCGTCGACAGTTGATACTATAAAGGATGCCGGCTTTAGGAGTGTCCGACTGCCAGTTACCTGGGCATATCA
TTTCACCGGAGGCTCACCTAATTGGACTATTGACCCAGCATGATTACAGCGAGTCTCTAATGTGGTTGATATGAT
TGTGGCTCGTGGAATCTACGCTATCGTTGATGTGCATCATGGTATGATATATGATCTTGTATCGGAGAAGGGCCT
TTACTGATATAAAACAGATTCATGGGTTTGGGCTGATGCTACCCAGTCTGGAACCAATCTTACTATGATTGAAGA
AAAATTCTATCGTCTCTGGTATCAAATTGGAACGAAGTTGGCCTGACAATCCAACCTAGTTGCCTTTGAGCCTAT
CAATGAGCCTCCTTGCAATACTGCGGTCGACGTTACCGAGTCCAACAAACTGAACAACATCTTTCTCCAGGCTAT
CAATGATGCTGGTGGGTTCAACTCGCAGAGAATTGTTAATCTAGTCGGAGGTGGTGAGGATAGCGTCAAGACTGC
AGACTGGTTTGTAGCACCCTCTGGATTTTGGAATCCATATGCTATTCAGTTCCACTACTACAGTCCCCGTGGGCC
ATAGATCAGTTTATACTTCAGGTATAATGCGTTGTGGGTTGAACTGGCCGAGTGGGCTTCTAGACGACTTGATAT
TCAGCGCTTGGTAAGAGTATAGACCCAGTTTTTTTTTTTTTTTTTTTTTTTAATTTTTTTATTTTTTTTTTTTTT
TTTATTTTTTTTTTTTTTTTTTTTTTTTTTTTCATTGTTTACTGATTTCAAACAGGGGAAAGACCATTTGGGGCT
CGGGGCTCTGACAGTGACAAGACTACTGTGCAGTCTGACTTCCAGCTGCTGCGCAACGCTTTCCCTGATGTACCT
CTCCTTTTGGGTGAATACGATGCTTCACCCACCAACACCGAACCCGCTGCCCGATATAAGTACCTTGACTTCTTG
ATCAAGACTGCAGCCAGTCTCGATATCTCCTGCGTGTTGTGGAATAACGGATTGGACCACTTGGATCGAACCGCA
GGAGTCTGGCGTGACTGTAACTCACTCTCGATCATCACAAAATCAACCGAGTCTACTGCCAATAGTTTACCAGAT
AGTACCGAGGACGCTTCTGCAACCACACATTCATAATCAGCTTATATTTTCCATCAGTATGGAACAGTTGTGACA
GCACAAACTCTTCCATTCATCTTCAACGGTAACACCCTCTCGTCAATCAGTGACTCCACTTGCTCGGCATTGTCG
TTGGGAACAGACTATTCTGTTTCGGGTGCAAATATAATATTCACAGCTTCGTACTTATCCAAGCATCTTTCATCT
ACGACAACACCGGGTATTAATGCCACTCTAACTCTGAGATTCTCGGGGGGCGATTCGTCCCCTGCTGTCCAAATT
GTTCAATGGAAAGCCCCAACTCTGTCGTCCACATCGGCGGTGGCTTCGACTGTCTCTGGCTCTGCCCTATCAATT
CCAATCACATGGGGCGGACTATCAACCGTCGCTGCATTAAAGGCCTTGACCAAGAGTGGAACATACCTGGTCGAT
GACTGGACGGTATCACTGAGCCCTATCCAGCAAGCGAGAGTTGTAAGCCAAGCCCTATTTCTCTTTGTGTACCAT
TTACTAATACTACTAATATATCGATCTAGACCTACAGCAACCAGTATAACTGGGATGACTCCAATGTAATCCTCA
CTTCATCTGCTATTAGCTGTCATCTCTGCTGGCCAATCGACCGTGTTCACCTTCGAGTTTTTCCCACGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail