Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6550.t1
Gene name
Locationscaffold_17:497920..499754
Strand-
Gene length (bp)1834
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01424 R3H R3H domain 2.1E-10 262 318
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.3E-05 113 183

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 46.30 27.75 64.86
5d_25C Five days - 25 degrees Celsius 41.00 24.14 57.86
7d_25C Seven days - 25 degrees Celsius 45.91 27.04 64.78
10d_25C Ten days - 25 degrees Celsius 45.70 27.25 64.15
7d_15C Seven days - 15 degrees Celsius 41.40 23.90 58.89
7d_30C Seven days - 30 degrees Celsius 53.40 32.02 74.77

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.677029 no
3d_25C 7d_25C 0.981265 no
3d_25C 7d_15C 0.705175 no
3d_25C 7d_30C 0.606329 no
3d_25C 10d_25C 0.971829 no
5d_25C 7d_25C 0.700784 no
5d_25C 7d_15C 0.981033 no
5d_25C 7d_30C 0.273650 no
5d_25C 10d_25C 0.712979 no
7d_25C 7d_15C 0.733225 no
7d_25C 7d_30C 0.583046 no
7d_25C 10d_25C 0.990283 no
7d_15C 7d_30C 0.297406 no
7d_15C 10d_25C 0.740103 no
7d_30C 10d_25C 0.570699 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6550.t1
MYEQDQMRYESARLERLNPSLQNNYGYDISGSQTWNPNGFANAQALGGIRSASASLKPNARGRAGLPTTWLDQQP
NMPQAFSNLGPGPIQSSAMRPEASASSADDDELIPTAIVIKNIPFAVKKEQLVQLMTELNLPLPYAFNYHFDNGV
FRGLAFANFTSAEETATVIEVLNHFELQGRKLRVEYKKMLPLQERERIEREKRERRGQLEEQHRPMGGGPQLQTQ
SSMSSLTSHIPATSPSPVSQRGQKIDVDLNDTQTLSYYSQLLLFKEDTVRDSVIFPHNLTPSQRRTVHTLAHNMG
LGHASRGSGEQRQVQVFKIAAGANVSPPTSSIPPSGQSDSGRRGLNRAATIDFGEARQEAGPGTFNTLRGQNSGF
LGVMDSPGNFANGQNLRAAKSFADLRSYTPSPVPSSASFPAALQSNGARLQYEGAPTGTSNTPTLTPVQSGSSLG
MQRDDNLLVNSLGGLSLGTGIGGPNSSPRRLRGMFSWEQDSQQSNAGAIGSNRGMGMGYDGQQERMPVRQPRGPT
PDKGPGFRRQNGHQSRGSDELRTNSGVEIIVE*
Coding >Pro_DTO377G3_2|g6550.t1
ATGTATGAGCAAGATCAGATGCGTTACGAGTCCGCTCGCCTCGAACGCTTGAACCCGTCCTTGCAGAACAACTAC
GGATATGATATATCTGGCTCGCAGACTTGGAACCCCAACGGGTTTGCCAATGCTCAAGCTCTCGGAGGAATCCGC
TCGGCCTCCGCCAGTTTGAAGCCTAATGCCCGTGGACGTGCCGGCCTCCCCACGACTTGGTTGGATCAGCAACCG
AATATGCCCCAAGCATTTTCGAATTTGGGCCCTGGTCCCATTCAGAGCAGCGCGATGCGACCGGAAGCCTCCGCG
TCCTCTGCAGATGACGATGAATTGATCCCAACCGCGATTGTCATCAAGAATATCCCCTTTGCCGTAAAGAAGGAA
CAGTTGGTACAGTTGATGACGGAACTCAACCTCCCCCTGCCCTACGCATTTAACTATCACTTTGACAATGGTGTC
TTCCGTGGTCTGGCCTTTGCCAACTTCACTTCCGCCGAGGAAACAGCAACCGTGATCGAGGTGCTCAACCACTTT
GAGCTACAGGGTCGGAAATTGCGAGTCGAATACAAGAAGATGCTTCCCCTGCAGGAGCGCGAACGGATCGAGCGT
GAGAAGCGGGAACGCCGTGGCCAGTTGGAAGAACAGCACCGCCCGATGGGAGGTGGTCCACAGCTCCAGACGCAG
AGCTCCATGTCTTCACTCACCTCGCACATCCCGGCCACCTCCCCTTCGCCCGTGTCCCAGCGTGGCCAAAAAATT
GATGTGGACTTGAACGACACCCAGACCCTTTCCTACTACTCCCAACTACTCCTGTTTAAGGAAGATACTGTCCGC
GATTCCGTGATCTTCCCCCACAACCTCACCCCCTCTCAGCGTCGCACGGTTCACACCCTGGCCCACAACATGGGC
TTGGGACATGCTTCACGTGGTAGCGGCGAACAGCGCCAGGTGCAAGTCTTTAAGATCGCCGCAGGTGCCAATGTC
AGCCCCCCGACGTCCTCAATCCCGCCCTCTGGCCAGTCAGACAGTGGTCGTCGCGGCCTTAACCGGGCGGCGACC
ATCGACTTCGGCGAGGCTCGCCAAGAGGCTGGCCCTGGCACTTTCAACACCTTGCGTGGACAGAACTCGGGCTTT
CTGGGCGTGATGGACTCTCCTGGCAACTTCGCCAACGGCCAGAACCTACGGGCTGCCAAGTCCTTTGCCGACCTG
AGATCTTACACTCCTTCGCCCGTGCCTTCCTCCGCTAGCTTCCCCGCCGCGTTGCAGTCCAACGGCGCCCGCCTC
CAGTATGAGGGTGCGCCCACTGGTACTTCCAACACCCCGACCCTCACCCCTGTCCAGTCTGGCTCCTCTCTTGGC
ATGCAGCGTGATGACAACCTGCTGGTCAACAGCCTGGGTGGTCTCTCCCTCGGCACCGGTATCGGTGGCCCCAAC
TCGAGCCCTCGTCGCTTAAGAGGCATGTTCTCTTGGGAGCAGGACAGCCAGCAATCCAACGCTGGCGCCATTGGA
AGCAACCGTGGCATGGGTATGGGATATGACGGCCAGCAGGAGCGCATGCCCGTCCGCCAACCCCGCGGCCCGACC
CCCGACAAGGGCCCCGGGTTTCGCCGTCAGAACGGCCACCAAAGCCGCGGAAGTGATGAACTCCGCACCAACTCC
GGAGTAGAGATCATTGTGGAGTAG
Transcript >Pro_DTO377G3_2|g6550.t1
ATGTATGAGCAAGATCAGATGCGTTACGAGTCCGCTCGCCTCGAACGCTTGAACCCGTCCTTGCAGAACAACTAC
GGATATGATATATCTGGCTCGCAGACTTGGAACCCCAACGGGTTTGCCAATGCTCAAGCTCTCGGAGGAATCCGC
TCGGCCTCCGCCAGTTTGAAGCCTAATGCCCGTGGACGTGCCGGCCTCCCCACGACTTGGTTGGATCAGCAACCG
AATATGCCCCAAGCATTTTCGAATTTGGGCCCTGGTCCCATTCAGAGCAGCGCGATGCGACCGGAAGCCTCCGCG
TCCTCTGCAGATGACGATGAATTGATCCCAACCGCGATTGTCATCAAGAATATCCCCTTTGCCGTAAAGAAGGAA
CAGTTGGTACAGTTGATGACGGAACTCAACCTCCCCCTGCCCTACGCATTTAACTATCACTTTGACAATGGTGTC
TTCCGTGGTCTGGCCTTTGCCAACTTCACTTCCGCCGAGGAAACAGCAACCGTGATCGAGGTGCTCAACCACTTT
GAGCTACAGGGTCGGAAATTGCGAGTCGAATACAAGAAGATGCTTCCCCTGCAGGAGCGCGAACGGATCGAGCGT
GAGAAGCGGGAACGCCGTGGCCAGTTGGAAGAACAGCACCGCCCGATGGGAGGTGGTCCACAGCTCCAGACGCAG
AGCTCCATGTCTTCACTCACCTCGCACATCCCGGCCACCTCCCCTTCGCCCGTGTCCCAGCGTGGCCAAAAAATT
GATGTGGACTTGAACGACACCCAGACCCTTTCCTACTACTCCCAACTACTCCTGTTTAAGGAAGATACTGTCCGC
GATTCCGTGATCTTCCCCCACAACCTCACCCCCTCTCAGCGTCGCACGGTTCACACCCTGGCCCACAACATGGGC
TTGGGACATGCTTCACGTGGTAGCGGCGAACAGCGCCAGGTGCAAGTCTTTAAGATCGCCGCAGGTGCCAATGTC
AGCCCCCCGACGTCCTCAATCCCGCCCTCTGGCCAGTCAGACAGTGGTCGTCGCGGCCTTAACCGGGCGGCGACC
ATCGACTTCGGCGAGGCTCGCCAAGAGGCTGGCCCTGGCACTTTCAACACCTTGCGTGGACAGAACTCGGGCTTT
CTGGGCGTGATGGACTCTCCTGGCAACTTCGCCAACGGCCAGAACCTACGGGCTGCCAAGTCCTTTGCCGACCTG
AGATCTTACACTCCTTCGCCCGTGCCTTCCTCCGCTAGCTTCCCCGCCGCGTTGCAGTCCAACGGCGCCCGCCTC
CAGTATGAGGGTGCGCCCACTGGTACTTCCAACACCCCGACCCTCACCCCTGTCCAGTCTGGCTCCTCTCTTGGC
ATGCAGCGTGATGACAACCTGCTGGTCAACAGCCTGGGTGGTCTCTCCCTCGGCACCGGTATCGGTGGCCCCAAC
TCGAGCCCTCGTCGCTTAAGAGGCATGTTCTCTTGGGAGCAGGACAGCCAGCAATCCAACGCTGGCGCCATTGGA
AGCAACCGTGGCATGGGTATGGGATATGACGGCCAGCAGGAGCGCATGCCCGTCCGCCAACCCCGCGGCCCGACC
CCCGACAAGGGCCCCGGGTTTCGCCGTCAGAACGGCCACCAAAGCCGCGGAAGTGATGAACTCCGCACCAACTCC
GGAGTAGAGATCATTGTGGAGTAG
Gene >Pro_DTO377G3_2|g6550.t1
ATGTATGAGCAAGATCAGATGCGTTACGAGTCCGCTCGCCTCGAACGCTTGAACCCGTCCTTGCAGAACAACTAC
GGATATGATATATCTGGCTCGCAGACTTGGAACCCCAACGGGTTTGCCAATGCTCAAGCTCTCGGAGGAATCCGC
TCGGCCTCCGCCAGTTTGAAGCCTAATGCCCGTGGACGTGCCGGCCTCCCCACGGTATGTTTGATCTTATCCGAC
AATGGACCCCCTCGTCCAAAGGTACGAAAAAGGCGAAAAAGGAAAAAAGTACTAACAGGCTTCTCCAGACTTGGT
TGGATCAGCAACCGAATATGCCCCAAGCATTTTCGAATTTGGGCCCTGGTCCCATTCAGAGCAGCGCGATGCGAC
CGGAAGCCTCCGCGTCCTCTGCAGATGACGATGAATTGATCCCAACCGCGATTGTCATCAAGAATATCCCCTTTG
CCGTAAAGAAGGAACAGTTGGTACAGTTGATGACGGAACTCAACCTCCCCCTGCCCTACGCATTTAACTATCACT
TTGACAATGGTGTCTTCCGTGGTCTGGCCTTTGCCAACTTCACTTCCGCCGAGGAAACAGCAACCGTGATCGAGG
TGCTCAACCACTTTGAGCTACAGGGTCGGAAATTGCGAGTCGAATACAAGAAGATGCTTCCCCTGCAGGAGCGCG
AACGGATCGAGCGTGAGAAGCGGGAACGCCGTGGCCAGTTGGAAGAACAGCACCGCCCGATGGGAGGTGGTCCAC
AGCTCCAGACGCAGAGCTCCATGTCTTCACTCACCTCGCACATCCCGGCCACCTCCCCTTCGCCCGTGTCCCAGC
GTGGCCAAAAAATTGGTGCGTTAACACATTCGTTTTAAGGTTATTGAAATCTCGACCTGTCGCTAACCATGTCTT
TTTTAATACAGATGTGGACTTGAACGACACCCAGACCCTTTCCTACTACTCCCAACTACTCCTGTTTAAGGAAGA
TACTGTCCGCGATTCCGTGATCTTCCCCCACAACCTCACCCCCTCTCAGCGTCGCACGGTTCACACCCTGGCCCA
CAACATGGGCTTGGGACATGCTTCACGTGGTAGCGGCGAACAGCGCCAGGTGCAAGTCTTTAAGATCGCCGCAGG
TGCCAATGTCAGCCCCCCGACGTCCTCAATCCCGCCCTCTGGCCAGTCAGACAGTGGTCGTCGCGGCCTTAACCG
GGCGGCGACCATCGACTTCGGCGAGGCTCGCCAAGAGGCTGGCCCTGGCACTTTCAACACCTTGCGTGGACAGAA
CTCGGGCTTTCTGGGCGTGATGGACTCTCCTGGCAACTTCGCCAACGGCCAGAACCTACGGGCTGCCAAGTCCTT
TGCCGACCTGAGATCTTACACTCCTTCGCCCGTGCCTTCCTCCGCTAGCTTCCCCGCCGCGTTGCAGTCCAACGG
CGCCCGCCTCCAGTATGAGGGTGCGCCCACTGGTACTTCCAACACCCCGACCCTCACCCCTGTCCAGTCTGGCTC
CTCTCTTGGCATGCAGCGTGATGACAACCTGCTGGTCAACAGCCTGGGTGGTCTCTCCCTCGGCACCGGTATCGG
TGGCCCCAACTCGAGCCCTCGTCGCTTAAGAGGCATGTTCTCTTGGGAGCAGGACAGCCAGCAATCCAACGCTGG
CGCCATTGGAAGCAACCGTGGCATGGGTATGGGATATGACGGCCAGCAGGAGCGCATGCCCGTCCGCCAACCCCG
CGGCCCGACCCCCGACAAGGGCCCCGGGTTTCGCCGTCAGAACGGCCACCAAAGCCGCGGAAGTGATGAACTCCG
CACCAACTCCGGAGTAGAGATCATTGTGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail