Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6540.t1
Gene name
Locationscaffold_17:475101..475914
Strand-
Gene length (bp)813
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01121 CoaE Dephospho-CoA kinase 6.8E-42 2 190

GO

GO Term Description Terminal node
GO:0004140 dephospho-CoA kinase activity Yes
GO:0005524 ATP binding Yes
GO:0015937 coenzyme A biosynthetic process Yes
GO:0006793 phosphorus metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0090407 organophosphate biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0017076 purine nucleotide binding No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0005488 binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0009058 biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009260 ribonucleotide biosynthetic process No
GO:0003824 catalytic activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034033 purine nucleoside bisphosphate biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0019693 ribose phosphate metabolic process No
GO:0015936 coenzyme A metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0008150 biological_process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0043167 ion binding No
GO:0072522 purine-containing compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0044238 primary metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044281 small molecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0016301 kinase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034030 ribonucleoside bisphosphate biosynthetic process No
GO:0033866 nucleoside bisphosphate biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0019637 organophosphate metabolic process No
GO:0032553 ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 229 251 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6540.t1
MLIIGLTGSIATGKSTVSSILSTPPYSLPIIDADLLARKVVEPGTAGYKAIVNYFGPSTPDLLLDDAPTNPNGKP
LNRPALGRRIFGSTEERKRDRQVLNGIVHPAVRWEVYKALIYHYLRGQWAVVLDVPLLFESGMDLICGTVIVVGV
HDPEIQTARLRARDAHLTAEDAANRVQSQGDVRTKATQAEFRGTTTGRGVVVWNDADKAQLEVAVRGAMASIAAS
SPKWWAWTLLAVPPVGVGVAAWNLIVNFATQKGWEKKKQEEKAKL*
Coding >Pro_DTO377G3_2|g6540.t1
ATGCTGATCATCGGGCTCACCGGCTCAATAGCAACGGGCAAGTCTACTGTCTCGTCCATCCTCTCCACACCACCC
TACTCCCTCCCAATAATCGACGCCGATCTCCTCGCCCGCAAAGTAGTCGAACCCGGCACCGCAGGCTACAAAGCT
ATCGTCAACTACTTCGGCCCTAGTACACCAGATCTACTATTGGACGATGCGCCTACAAATCCAAACGGGAAGCCA
CTGAATCGGCCAGCGTTAGGGCGGCGCATTTTCGGCAGCACAGAAGAACGCAAACGGGATCGACAAGTCCTCAAC
GGCATCGTCCACCCCGCCGTACGGTGGGAAGTCTACAAAGCCCTAATCTACCACTACCTGCGTGGCCAATGGGCG
GTTGTCCTGGATGTACCGCTCCTCTTCGAGAGCGGGATGGATCTCATCTGCGGAACCGTAATCGTGGTCGGGGTT
CACGATCCTGAAATCCAAACGGCGCGGTTGCGCGCCCGCGATGCACATCTCACAGCCGAGGATGCAGCGAACCGG
GTCCAGAGTCAGGGAGATGTGCGGACGAAAGCGACGCAGGCGGAGTTCCGGGGGACGACGACGGGGCGCGGGGTA
GTGGTTTGGAATGATGCTGATAAAGCACAGCTGGAGGTTGCTGTTAGGGGGGCTATGGCTAGTATTGCAGCTTCC
AGTCCGAAATGGTGGGCTTGGACCTTGTTGGCTGTGCCGCCGGTTGGGGTTGGGGTTGCTGCTTGGAATTTGATT
GTGAATTTCGCGACGCAGAAGGGGTGGGAGAAAAAGAAGCAGGAGGAGAAGGCGAAGCTTTGA
Transcript >Pro_DTO377G3_2|g6540.t1
ATGCTGATCATCGGGCTCACCGGCTCAATAGCAACGGGCAAGTCTACTGTCTCGTCCATCCTCTCCACACCACCC
TACTCCCTCCCAATAATCGACGCCGATCTCCTCGCCCGCAAAGTAGTCGAACCCGGCACCGCAGGCTACAAAGCT
ATCGTCAACTACTTCGGCCCTAGTACACCAGATCTACTATTGGACGATGCGCCTACAAATCCAAACGGGAAGCCA
CTGAATCGGCCAGCGTTAGGGCGGCGCATTTTCGGCAGCACAGAAGAACGCAAACGGGATCGACAAGTCCTCAAC
GGCATCGTCCACCCCGCCGTACGGTGGGAAGTCTACAAAGCCCTAATCTACCACTACCTGCGTGGCCAATGGGCG
GTTGTCCTGGATGTACCGCTCCTCTTCGAGAGCGGGATGGATCTCATCTGCGGAACCGTAATCGTGGTCGGGGTT
CACGATCCTGAAATCCAAACGGCGCGGTTGCGCGCCCGCGATGCACATCTCACAGCCGAGGATGCAGCGAACCGG
GTCCAGAGTCAGGGAGATGTGCGGACGAAAGCGACGCAGGCGGAGTTCCGGGGGACGACGACGGGGCGCGGGGTA
GTGGTTTGGAATGATGCTGATAAAGCACAGCTGGAGGTTGCTGTTAGGGGGGCTATGGCTAGTATTGCAGCTTCC
AGTCCGAAATGGTGGGCTTGGACCTTGTTGGCTGTGCCGCCGGTTGGGGTTGGGGTTGCTGCTTGGAATTTGATT
GTGAATTTCGCGACGCAGAAGGGGTGGGAGAAAAAGAAGCAGGAGGAGAAGGCGAAGCTTTGA
Gene >Pro_DTO377G3_2|g6540.t1
ATGCTGATCATCGGGCTCACCGGCTCAATAGCAACGGGCAAGTCTACTGTCTCGTCCATCCTCTCCACACCACCC
TACTCCCTCCCAATAATCGACGCCGATCTCCTCGCCCGCAAAGTAGTCGAACCCGGCACCGCAGGCTACAAAGCT
ATCGTCAACTACTTCGGCCCTAGTACACCAGATCTACTATTGGACGATGCGCCTACAAATCCAAACGGGAAGCCA
CTGAATCGGCCAGCGTTAGGGCGGCGCATTTTCGGCAGCACAGAAGAACGCAAACGGGATCGACAAGTCCTCAAC
GGCATCGTCCACCCCGCCGTACGGTGGGAAGTCTACAAAGCCCTAATCTACCACTACCTGCGTGGCCAATGGGCG
GTTGTCCTGGATGTACCGCTCCTCTTCGAGAGCGGGATGGATCTCATCTGCGGAACCGTAATCGTGGTCGGGGTT
CACGATCCTGAAATCCAAACGGCGCGGTTGCGCGCCCGCGATGCACATCTCACAGCCGAGGATGCAGCGAACCGG
GTCCAGAGTCAGGGAGATGTGCGGACGAAAGCGACGCAGGCGGAGTTCCGGGGGACGACGACGGGGCGCGGGGTA
GTGGTTTGGAATGATGCTGATAAAGCACAGCTGGAGGTTGCTGTTAGGGGGGCTATGGCTAGTATTGCAGCTTCC
AGTCCGAAATGGTGGGCTTGGACCTTGTTGGCTGTGCCGCCGGTTGGGGTTGGGGTTGCTGCTTGGAATTTGATT
GTGAATTTCGCGACGCAGAAGGGGTGGGAGAAAAAGAAGCAGGAGGAGAAGGCGAAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail