Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6498.t1
Gene name
Locationscaffold_17:377734..379301
Strand-
Gene length (bp)1567
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11931 DUF3449 Domain of unknown function (DUF3449) 7.6E-75 314 502
PF16837 SF3A3 Pre-mRNA-splicing factor SF3A3, of SF3a complex, Prp9 2.5E-25 126 208
PF12108 SF3a60_bindingd Splicing factor SF3a60 binding domain 2.7E-15 72 98
PF12874 zf-met Zinc-finger of C2H2 type 6.7E-07 253 276
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.5E-07 253 276

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6498.t1
MLLEDQRFIHEDLERLEQAIADRVAEEPRNARGHLARDHEVSQFLDRIESQSQRLLEIYRDADGLRQKEVQSIST
GDQFEEFYKQLGEIKEHHKRYPNEPTENLEQAYNRRQTGEGEAPRTAIDNMFTGEEGFGQYLDLTTIHEDYLNLP
GVKRLSYVQYLDIFDCFTSPVLPIKRKDKLSDRYFNYVGELASYLESFIKRVQPLQPLNELFASFDDEFEKQWVA
KEVPGWTDEKSANGASGPATEGTGEGIWCADCEKEFKNENVLRSHLTGKKHIRAAEARKAAGASNEKPSASQGTS
SAHSLKEREVARREHQVRSLANVLREQRQATRINVERRQGMTERERQMEWEAVQAGLDHTGPEPRAGEESDEEDE
EVIYNPLKLPLAWDGKPIPFWLYKLHGLGVEYQCEICGNYTYMGRRAFDKHFSENLHVHGLKCLGITSNTNLFRE
ITSINEAMALWDQLEKDRKKDRDSRDNVVQMEDAEGNVMPERIYLDLQKQGIL*
Coding >Pro_DTO377G3_2|g6498.t1
ATGTTGCTCGAAGATCAAAGGTTCATCCACGAGGATCTAGAGCGGCTAGAACAGGCTATCGCTGATCGCGTGGCG
GAAGAGCCCCGAAATGCTCGAGGCCACTTGGCTCGCGACCATGAAGTCTCCCAGTTCCTAGACAGAATTGAGAGT
CAGTCCCAGCGACTCTTAGAGATCTACCGGGACGCCGATGGATTGCGGCAGAAGGAAGTGCAGTCTATCTCGACA
GGCGATCAATTCGAAGAATTTTACAAGCAGCTAGGGGAAATTAAAGAGCACCACAAGCGCTACCCGAACGAACCA
ACCGAGAACCTCGAGCAAGCATATAATCGCCGTCAGACCGGCGAAGGAGAGGCTCCCCGCACCGCAATCGATAAT
ATGTTCACTGGCGAAGAAGGCTTTGGACAGTATCTGGATCTCACAACTATTCACGAAGATTACCTGAATCTTCCC
GGGGTTAAGCGCTTGTCATACGTCCAATACCTCGATATCTTCGACTGCTTCACATCCCCTGTTTTGCCAATTAAG
CGGAAAGACAAGCTCTCTGATCGTTATTTCAACTATGTTGGCGAGCTTGCTAGCTATCTGGAGAGTTTCATCAAG
AGAGTTCAGCCACTGCAACCCTTGAACGAGCTTTTCGCCAGCTTCGACGACGAATTCGAAAAACAATGGGTTGCG
AAGGAGGTTCCCGGTTGGACAGATGAAAAGTCTGCGAATGGTGCGTCTGGCCCAGCTACCGAAGGGACCGGTGAG
GGTATTTGGTGCGCAGATTGCGAGAAGGAATTTAAGAATGAGAACGTCCTCCGGAGCCACTTGACCGGCAAGAAA
CATATTCGGGCGGCAGAAGCCCGCAAAGCAGCAGGCGCATCCAACGAGAAACCATCAGCATCTCAAGGCACATCT
TCGGCCCATAGCCTCAAGGAGCGCGAAGTTGCACGACGCGAACATCAAGTTCGATCCTTGGCGAATGTTCTGCGC
GAGCAGCGACAAGCGACACGAATCAATGTTGAGCGCCGACAGGGTATGACTGAACGTGAACGCCAAATGGAATGG
GAAGCTGTGCAGGCTGGGCTCGATCACACAGGTCCCGAGCCTCGTGCCGGCGAAGAATCAGATGAAGAGGACGAG
GAGGTTATCTACAACCCATTGAAATTGCCACTGGCATGGGATGGAAAACCTATTCCATTCTGGCTCTACAAGCTC
CATGGCCTCGGCGTCGAATATCAGTGCGAGATTTGCGGAAACTACACCTACATGGGTCGACGAGCATTCGACAAA
CACTTCTCTGAAAACCTCCACGTCCACGGATTAAAGTGTCTCGGCATTACCTCCAACACCAATCTCTTCCGTGAG
ATCACCAGTATCAATGAGGCTATGGCGCTTTGGGATCAGCTCGAAAAGGATCGGAAGAAGGACAGAGATTCACGG
GATAATGTCGTTCAGATGGAGGATGCAGAGGGTAACGTTATGCCCGAAAGGATCTACTTGGATTTGCAAAAGCAG
GGTATTCTCTAA
Transcript >Pro_DTO377G3_2|g6498.t1
ATGTTGCTCGAAGATCAAAGGTTCATCCACGAGGATCTAGAGCGGCTAGAACAGGCTATCGCTGATCGCGTGGCG
GAAGAGCCCCGAAATGCTCGAGGCCACTTGGCTCGCGACCATGAAGTCTCCCAGTTCCTAGACAGAATTGAGAGT
CAGTCCCAGCGACTCTTAGAGATCTACCGGGACGCCGATGGATTGCGGCAGAAGGAAGTGCAGTCTATCTCGACA
GGCGATCAATTCGAAGAATTTTACAAGCAGCTAGGGGAAATTAAAGAGCACCACAAGCGCTACCCGAACGAACCA
ACCGAGAACCTCGAGCAAGCATATAATCGCCGTCAGACCGGCGAAGGAGAGGCTCCCCGCACCGCAATCGATAAT
ATGTTCACTGGCGAAGAAGGCTTTGGACAGTATCTGGATCTCACAACTATTCACGAAGATTACCTGAATCTTCCC
GGGGTTAAGCGCTTGTCATACGTCCAATACCTCGATATCTTCGACTGCTTCACATCCCCTGTTTTGCCAATTAAG
CGGAAAGACAAGCTCTCTGATCGTTATTTCAACTATGTTGGCGAGCTTGCTAGCTATCTGGAGAGTTTCATCAAG
AGAGTTCAGCCACTGCAACCCTTGAACGAGCTTTTCGCCAGCTTCGACGACGAATTCGAAAAACAATGGGTTGCG
AAGGAGGTTCCCGGTTGGACAGATGAAAAGTCTGCGAATGGTGCGTCTGGCCCAGCTACCGAAGGGACCGGTGAG
GGTATTTGGTGCGCAGATTGCGAGAAGGAATTTAAGAATGAGAACGTCCTCCGGAGCCACTTGACCGGCAAGAAA
CATATTCGGGCGGCAGAAGCCCGCAAAGCAGCAGGCGCATCCAACGAGAAACCATCAGCATCTCAAGGCACATCT
TCGGCCCATAGCCTCAAGGAGCGCGAAGTTGCACGACGCGAACATCAAGTTCGATCCTTGGCGAATGTTCTGCGC
GAGCAGCGACAAGCGACACGAATCAATGTTGAGCGCCGACAGGGTATGACTGAACGTGAACGCCAAATGGAATGG
GAAGCTGTGCAGGCTGGGCTCGATCACACAGGTCCCGAGCCTCGTGCCGGCGAAGAATCAGATGAAGAGGACGAG
GAGGTTATCTACAACCCATTGAAATTGCCACTGGCATGGGATGGAAAACCTATTCCATTCTGGCTCTACAAGCTC
CATGGCCTCGGCGTCGAATATCAGTGCGAGATTTGCGGAAACTACACCTACATGGGTCGACGAGCATTCGACAAA
CACTTCTCTGAAAACCTCCACGTCCACGGATTAAAGTGTCTCGGCATTACCTCCAACACCAATCTCTTCCGTGAG
ATCACCAGTATCAATGAGGCTATGGCGCTTTGGGATCAGCTCGAAAAGGATCGGAAGAAGGACAGAGATTCACGG
GATAATGTCGTTCAGATGGAGGATGCAGAGGGTAACGTTATGCCCGAAAGGATCTACTTGGATTTGCAAAAGCAG
GGTATTCTCTAA
Gene >Pro_DTO377G3_2|g6498.t1
ATGTTGCTCGAAGATCAAAGGTTCATCCACGAGGATCTAGAGCGGCTAGAACAGGCTATCGCTGATCGCGTGGCG
GAAGAGCCCCGAAATGTGAGTATACCGCCCAAAATTGTCAGTCACACTTTCTCATATACCGATTAATCAGGCTCG
AGGCCACTTGGCTCGCGACCATGAAGTCTCCCAGTTCCTAGACAGAATTGAGAGTCAGTCCCAGCGACTCTTAGA
GATCTACCGGGACGCCGATGGATTGCGGCAGAAGGAAGTGCAGTCTATCTCGACAGGCGATCAATTCGAAGAATT
TTACAAGCAGCTAGGGGAAATTAAAGAGCACCACAAGCGCTACCCGAACGAACCAACCGAGAACCTCGAGCAAGC
ATATAATCGCCGTCAGACCGGCGAAGGAGAGGCTCCCCGCACCGCAATCGATAATATGTTCACTGGCGAAGAAGG
CTTTGGACAGTATCTGGATCTCACAACTATTCACGAAGATTACCTGAATCTTCCCGGGGTTAAGCGCTTGTCATA
CGTCCAATACCTCGATATCTTCGACTGCTTCACATCCCCTGTTTTGCCAATTAAGCGGAAAGACAAGCTCTCTGA
TCGTTATTTCAACTATGTTGGCGAGCTTGCTAGCTATCTGGAGAGTTTCATCAAGAGAGTTCAGCCACTGCAACC
CTTGAACGAGCTTTTCGCCAGCTTCGACGACGAATTCGAAAAACAATGGGTTGCGAAGGAGGTTCCCGGTTGGAC
AGATGAAAAGTCTGCGAATGGTGCGTCTGGCCCAGCTACCGAAGGGACCGGTGAGGGTATTTGGTGCGCAGATTG
CGAGAAGGAATTTAAGAATGAGAACGTCCTCCGGAGCCACTTGACCGGCAAGAAACATATTCGGGCGGCAGAAGC
CCGCAAAGCAGCAGGCGCATCCAACGAGAAACCATCAGCATCTCAAGGCACATCTTCGGCCCATAGCCTCAAGGA
GCGCGAAGTTGCACGACGCGAACATCAAGTTCGATCCTTGGCGAATGTTCTGCGCGAGCAGCGACAAGCGACACG
AATCAATGTTGAGCGCCGACAGGGTATGACTGAACGTGAACGCCAAATGGAATGGGAAGCTGTGCAGGCTGGGCT
CGATCACACAGGTCCCGAGCCTCGTGCCGGCGAAGAATCAGATGAAGAGGACGAGGAGGTTATCTACAACCCATT
GAAATTGCCACTGGCATGGGATGGAAAACCTATTCCATTCTGGCTCTACAAGCTCCATGGCCTCGGCGTCGAATA
TCAGTGCGAGATTTGCGGAAACTACACCTACATGGGTCGACGAGCATTCGACAAACACTTCTCTGAAAACCTCCA
CGTCCACGGATTAAAGTGTCTCGGCATTACCTCCAACACCAATCTCTTCCGTGAGATCACCAGTATCAATGAGGC
TATGGCGCTTTGGGATCAGCTCGAAAAGGATCGGAAGAAGGACAGAGATTCACGGGATAATGTCGTTCAGATGGA
GGATGCAGAGGGTAACGTTATGCCCGAAAGGATCTACTTGGATTTGCAAAAGCAGGGTATTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail