Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6480.t1
Gene name
Locationscaffold_17:312379..312700
Strand+
Gene length (bp)321
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01988 VIT1 VIT family 1.1E-27 33 103

GO

GO Term Description Terminal node
GO:0030026 cellular manganese ion homeostasis Yes
GO:0005384 manganese ion transmembrane transporter activity Yes
GO:0065007 biological regulation No
GO:0055065 metal ion homeostasis No
GO:0006873 cellular ion homeostasis No
GO:0046916 cellular transition metal ion homeostasis No
GO:0030003 cellular cation homeostasis No
GO:0008150 biological_process No
GO:0065008 regulation of biological quality No
GO:0006875 cellular metal ion homeostasis No
GO:0022857 transmembrane transporter activity No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0055071 manganese ion homeostasis No
GO:0098771 inorganic ion homeostasis No
GO:0042592 homeostatic process No
GO:0008324 cation transmembrane transporter activity No
GO:0055080 cation homeostasis No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0048878 chemical homeostasis No
GO:0019725 cellular homeostasis No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0055082 cellular chemical homeostasis No
GO:0009987 cellular process No
GO:0046873 metal ion transmembrane transporter activity No
GO:0055076 transition metal ion homeostasis No
GO:0050801 ion homeostasis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 62 84 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6480.t1
MASTIYMASEHVVEQLNQTHAANEKHFDSGEVMRDMIIGLADGMTVPFALTAGLSSLGSSKLVILGGLAELFSGS
ISMGLGAYLAAVTDRDHYENEEKREQGETRA*
Coding >Pro_DTO377G3_2|g6480.t1
ATGGCTAGCACTATCTACATGGCAAGTGAGCATGTGGTCGAACAACTAAATCAAACCCATGCCGCCAACGAAAAG
CATTTCGATTCAGGGGAGGTCATGCGAGACATGATTATTGGTCTGGCTGATGGAATGACAGTACCGTTTGCTCTG
ACGGCTGGTCTATCTAGCCTAGGCTCTTCCAAGCTGGTCATCCTCGGCGGTCTTGCTGAACTCTTCAGTGGGTCG
ATCTCAATGGGCTTAGGGGCCTATCTTGCTGCTGTAACTGATCGAGACCATTATGAGAACGAGGAGAAACGAGAG
CAAGGAGAAACGAGAGCGTGA
Transcript >Pro_DTO377G3_2|g6480.t1
ATGGCTAGCACTATCTACATGGCAAGTGAGCATGTGGTCGAACAACTAAATCAAACCCATGCCGCCAACGAAAAG
CATTTCGATTCAGGGGAGGTCATGCGAGACATGATTATTGGTCTGGCTGATGGAATGACAGTACCGTTTGCTCTG
ACGGCTGGTCTATCTAGCCTAGGCTCTTCCAAGCTGGTCATCCTCGGCGGTCTTGCTGAACTCTTCAGTGGGTCG
ATCTCAATGGGCTTAGGGGCCTATCTTGCTGCTGTAACTGATCGAGACCATTATGAGAACGAGGAGAAACGAGAG
CAAGGAGAAACGAGAGCGTGA
Gene >Pro_DTO377G3_2|g6480.t1
ATGGCTAGCACTATCTACATGGCAAGTGAGCATGTGGTCGAACAACTAAATCAAACCCATGCCGCCAACGAAAAG
CATTTCGATTCAGGGGAGGTCATGCGAGACATGATTATTGGTCTGGCTGATGGAATGACAGTACCGTTTGCTCTG
ACGGCTGGTCTATCTAGCCTAGGCTCTTCCAAGCTGGTCATCCTCGGCGGTCTTGCTGAACTCTTCAGTGGGTCG
ATCTCAATGGGCTTAGGGGCCTATCTTGCTGCTGTAACTGATCGAGACCATTATGAGAACGAGGAGAAACGAGAG
CAAGGAGAAACGAGAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail