Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6477.t1
Gene name
Locationscaffold_17:302408..305625
Strand-
Gene length (bp)3217
Transcript length (bp)2862
Coding sequence length (bp)2862
Protein length (aa) 954

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain 8.8E-17 109 272
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 5.5E-05 375 514

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0030259 lipid glycosylation Yes
GO:0016758 transferase activity, transferring hexosyl groups Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0030258 lipid modification No
GO:0006629 lipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0070085 glycosylation No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6477.t1
MATVLAPNPAEISFERMDINRSGDWASEGTKRASDDPDGVQFFEDGLNARILGDGRVDIHIDQHKPHLGGLLKHI
QRADIHSERDSECAVSAERPYTNDEHFPLHLNLVIQVIGSRGDIQPFVALGKELKAHGHRVRLATHLAFRQFVLD
TGLEFFNIGGDPEELMAYMVKNPGLLPGFKAIRSGDIQRRRREMKEIFNGCWKSCFEKGDGTYLHQIKEDPFSKT
VDYRQRPFVADAIIANPPSLAHIHCAQRLGIPLHIIFTMPWSPTQSFPHPLANVHRRNCKPTIANFVSYNIVDMM
VWEGLGDILNTLRKNTLALQPLDTMTAPSILHRLHVPHTYMWSPSLLPKPPDWADNIDVCGFGFLLSETSYTPPT
EIAAFLDAGPKPIYIGFGSIVVDNANKLTKTIFEAVKNSGQRALISKGWGNLGADEVPDNILMIGNCPHDWLFGQ
VSCVIHHGGAGTTAAGLALGRPTIIVPFFGDQQFWGNIVARAGAGPAPIPHKILNVQNLSSAIAKALEPSTLERA
QTIALKMQEESGVRHGVNSFHRNLDPQSYRCSIVPNHPAAWHLKHTRINLSAFAATVLVRSGKISPDMLVLYRPI
EYDTLLDPADPLTASAQVLFGVITSFVTGLVDAPREIVHDIVSAARSIRQPHEHFDRHAACQAVLSSPDHLSPEN
NDGTETHIQNENEQLQIENEEQRDGEILEGESAQEDTTDADNETDINSIDRIRSTERKRNIQLEKAKTMSSSMTP
TNPPKSTILHEAALHGSQMSKKILKIIIVVPTDLTLSMARGFHNAPKLYHDTTVTDTPQVVSLRSGFRAAGKEFR
DGFYFGIKGLGTQPHHGLKHGGAKGLLKGVGKGIGGLFLKPTAGLWGLAGYPLSGIVREINDSLGRHQKCMIVMG
RISQGLEEMRESTAQEREEVSRGWITIEHDLKKLKTHHHLHMSDSTHAVVLFE*
Coding >Pro_DTO377G3_2|g6477.t1
ATGGCAACTGTACTAGCACCAAATCCTGCAGAAATATCATTCGAGAGAATGGACATCAATCGCTCGGGTGATTGG
GCGAGTGAAGGTACTAAGCGAGCATCAGATGACCCCGATGGAGTGCAATTCTTCGAGGATGGGTTGAACGCCCGT
ATTCTAGGTGACGGCCGAGTGGATATCCATATCGATCAGCATAAACCGCACCTCGGAGGGCTATTAAAGCACATC
CAACGCGCGGATATACATTCTGAGCGAGATTCCGAATGCGCTGTCAGCGCGGAACGGCCCTACACGAATGATGAG
CATTTCCCACTGCACTTAAACCTGGTCATCCAAGTTATTGGTTCTCGAGGCGATATTCAACCATTTGTGGCACTA
GGGAAAGAACTGAAAGCACACGGTCATCGAGTCAGATTGGCCACACATTTAGCTTTTCGGCAGTTTGTTCTCGAT
ACCGGTCTAGAGTTCTTCAATATCGGAGGAGACCCAGAGGAGCTGATGGCTTATATGGTCAAAAATCCGGGCCTT
TTACCGGGCTTCAAGGCAATACGCAGCGGAGATATCCAGAGGCGTCGCCGTGAGATGAAGGAAATCTTCAATGGA
TGTTGGAAATCTTGCTTTGAAAAGGGTGATGGGACTTACCTTCACCAGATTAAGGAAGACCCATTCAGTAAGACA
GTGGATTACCGACAGCGGCCCTTTGTGGCGGATGCTATTATAGCAAACCCTCCTAGCCTTGCCCATATCCATTGC
GCCCAACGACTGGGTATCCCTCTCCATATCATATTCACGATGCCCTGGTCACCAACCCAGTCTTTTCCCCACCCG
TTAGCGAATGTCCACCGCCGGAACTGCAAGCCAACTATCGCAAATTTCGTGTCCTACAATATCGTCGATATGATG
GTATGGGAAGGATTAGGAGATATTCTGAACACACTTCGCAAAAATACCTTGGCACTCCAACCCCTGGATACAATG
ACTGCCCCAAGCATACTACACCGACTACATGTGCCACATACGTATATGTGGTCCCCTTCATTACTACCTAAGCCC
CCTGATTGGGCTGATAACATCGATGTATGCGGCTTTGGCTTCCTCCTCTCAGAGACCAGCTACACACCACCAACG
GAAATAGCTGCATTTCTCGACGCAGGACCAAAACCAATATACATTGGTTTTGGCTCGATCGTAGTTGATAATGCG
AACAAACTGACAAAAACCATATTTGAAGCAGTCAAAAATTCCGGACAGCGGGCTCTTATCTCAAAAGGCTGGGGG
AATTTGGGGGCAGACGAAGTGCCGGACAATATTCTGATGATTGGAAACTGCCCTCACGATTGGCTGTTTGGGCAG
GTTTCATGTGTTATCCACCATGGTGGTGCTGGCACCACAGCGGCAGGGCTCGCGCTAGGTCGACCGACAATAATT
GTCCCTTTCTTTGGAGACCAGCAATTCTGGGGAAACATCGTTGCGCGTGCTGGAGCTGGGCCAGCACCAATACCA
CATAAAATTTTGAACGTGCAGAATCTCTCAAGCGCAATCGCGAAAGCGCTAGAGCCGAGTACTCTAGAGAGAGCA
CAGACGATCGCGTTGAAAATGCAGGAAGAGTCTGGTGTGCGCCATGGGGTGAATAGCTTTCATCGAAATCTTGAC
CCCCAGTCATACAGATGCTCTATAGTCCCGAATCATCCGGCGGCTTGGCATCTCAAACATACCAGAATCAACCTC
AGTGCCTTTGCAGCAACGGTTCTAGTGAGATCAGGGAAGATCAGCCCAGATATGCTCGTGCTTTACCGTCCAATT
GAGTATGATACATTACTGGACCCTGCCGACCCACTTACTGCTAGTGCTCAGGTGCTCTTTGGAGTCATTACGAGC
TTCGTGACTGGGCTTGTCGATGCGCCCAGAGAGATTGTGCATGATATTGTTTCTGCTGCTCGCTCAATACGCCAA
CCCCATGAACATTTTGATCGCCACGCAGCATGTCAGGCAGTACTTTCTTCACCAGATCATTTATCTCCAGAGAAT
AATGATGGGACTGAAACACATATTCAAAATGAGAACGAGCAATTGCAGATTGAGAATGAGGAACAGCGAGATGGT
GAAATCCTAGAAGGGGAGAGTGCACAGGAAGATACTACCGATGCGGACAATGAAACCGATATCAACAGCATTGAT
CGAATTCGGAGCACAGAACGCAAAAGGAATATCCAGCTCGAAAAGGCCAAGACAATGAGCAGCTCGATGACACCG
ACAAATCCACCTAAATCTACTATTTTACACGAAGCTGCGTTACACGGAAGTCAAATGTCCAAGAAAATATTGAAG
ATAATCATAGTGGTACCGACCGATTTGACACTGAGCATGGCCAGAGGTTTCCACAACGCACCCAAATTATATCAC
GACACGACAGTAACCGACACCCCCCAGGTGGTCAGTCTTCGAAGCGGGTTCAGGGCGGCAGGAAAGGAGTTCCGA
GATGGATTTTACTTCGGTATTAAGGGCCTAGGAACACAGCCGCATCATGGTCTTAAGCACGGAGGTGCTAAGGGG
CTTCTCAAAGGTGTCGGAAAAGGAATCGGTGGGTTGTTTCTCAAGCCGACAGCAGGGTTATGGGGTCTAGCAGGA
TATCCCTTAAGCGGGATAGTCAGAGAGATCAATGACTCGCTAGGCAGACATCAAAAATGCATGATTGTAATGGGT
CGAATTTCGCAAGGACTCGAAGAGATGCGAGAATCCACGGCCCAGGAAAGGGAAGAGGTATCCAGGGGATGGATT
ACTATTGAACACGACTTGAAAAAGTTGAAAACGCACCACCATTTGCATATGTCGGACTCCACTCATGCTGTGGTG
TTATTTGAGTGA
Transcript >Pro_DTO377G3_2|g6477.t1
ATGGCAACTGTACTAGCACCAAATCCTGCAGAAATATCATTCGAGAGAATGGACATCAATCGCTCGGGTGATTGG
GCGAGTGAAGGTACTAAGCGAGCATCAGATGACCCCGATGGAGTGCAATTCTTCGAGGATGGGTTGAACGCCCGT
ATTCTAGGTGACGGCCGAGTGGATATCCATATCGATCAGCATAAACCGCACCTCGGAGGGCTATTAAAGCACATC
CAACGCGCGGATATACATTCTGAGCGAGATTCCGAATGCGCTGTCAGCGCGGAACGGCCCTACACGAATGATGAG
CATTTCCCACTGCACTTAAACCTGGTCATCCAAGTTATTGGTTCTCGAGGCGATATTCAACCATTTGTGGCACTA
GGGAAAGAACTGAAAGCACACGGTCATCGAGTCAGATTGGCCACACATTTAGCTTTTCGGCAGTTTGTTCTCGAT
ACCGGTCTAGAGTTCTTCAATATCGGAGGAGACCCAGAGGAGCTGATGGCTTATATGGTCAAAAATCCGGGCCTT
TTACCGGGCTTCAAGGCAATACGCAGCGGAGATATCCAGAGGCGTCGCCGTGAGATGAAGGAAATCTTCAATGGA
TGTTGGAAATCTTGCTTTGAAAAGGGTGATGGGACTTACCTTCACCAGATTAAGGAAGACCCATTCAGTAAGACA
GTGGATTACCGACAGCGGCCCTTTGTGGCGGATGCTATTATAGCAAACCCTCCTAGCCTTGCCCATATCCATTGC
GCCCAACGACTGGGTATCCCTCTCCATATCATATTCACGATGCCCTGGTCACCAACCCAGTCTTTTCCCCACCCG
TTAGCGAATGTCCACCGCCGGAACTGCAAGCCAACTATCGCAAATTTCGTGTCCTACAATATCGTCGATATGATG
GTATGGGAAGGATTAGGAGATATTCTGAACACACTTCGCAAAAATACCTTGGCACTCCAACCCCTGGATACAATG
ACTGCCCCAAGCATACTACACCGACTACATGTGCCACATACGTATATGTGGTCCCCTTCATTACTACCTAAGCCC
CCTGATTGGGCTGATAACATCGATGTATGCGGCTTTGGCTTCCTCCTCTCAGAGACCAGCTACACACCACCAACG
GAAATAGCTGCATTTCTCGACGCAGGACCAAAACCAATATACATTGGTTTTGGCTCGATCGTAGTTGATAATGCG
AACAAACTGACAAAAACCATATTTGAAGCAGTCAAAAATTCCGGACAGCGGGCTCTTATCTCAAAAGGCTGGGGG
AATTTGGGGGCAGACGAAGTGCCGGACAATATTCTGATGATTGGAAACTGCCCTCACGATTGGCTGTTTGGGCAG
GTTTCATGTGTTATCCACCATGGTGGTGCTGGCACCACAGCGGCAGGGCTCGCGCTAGGTCGACCGACAATAATT
GTCCCTTTCTTTGGAGACCAGCAATTCTGGGGAAACATCGTTGCGCGTGCTGGAGCTGGGCCAGCACCAATACCA
CATAAAATTTTGAACGTGCAGAATCTCTCAAGCGCAATCGCGAAAGCGCTAGAGCCGAGTACTCTAGAGAGAGCA
CAGACGATCGCGTTGAAAATGCAGGAAGAGTCTGGTGTGCGCCATGGGGTGAATAGCTTTCATCGAAATCTTGAC
CCCCAGTCATACAGATGCTCTATAGTCCCGAATCATCCGGCGGCTTGGCATCTCAAACATACCAGAATCAACCTC
AGTGCCTTTGCAGCAACGGTTCTAGTGAGATCAGGGAAGATCAGCCCAGATATGCTCGTGCTTTACCGTCCAATT
GAGTATGATACATTACTGGACCCTGCCGACCCACTTACTGCTAGTGCTCAGGTGCTCTTTGGAGTCATTACGAGC
TTCGTGACTGGGCTTGTCGATGCGCCCAGAGAGATTGTGCATGATATTGTTTCTGCTGCTCGCTCAATACGCCAA
CCCCATGAACATTTTGATCGCCACGCAGCATGTCAGGCAGTACTTTCTTCACCAGATCATTTATCTCCAGAGAAT
AATGATGGGACTGAAACACATATTCAAAATGAGAACGAGCAATTGCAGATTGAGAATGAGGAACAGCGAGATGGT
GAAATCCTAGAAGGGGAGAGTGCACAGGAAGATACTACCGATGCGGACAATGAAACCGATATCAACAGCATTGAT
CGAATTCGGAGCACAGAACGCAAAAGGAATATCCAGCTCGAAAAGGCCAAGACAATGAGCAGCTCGATGACACCG
ACAAATCCACCTAAATCTACTATTTTACACGAAGCTGCGTTACACGGAAGTCAAATGTCCAAGAAAATATTGAAG
ATAATCATAGTGGTACCGACCGATTTGACACTGAGCATGGCCAGAGGTTTCCACAACGCACCCAAATTATATCAC
GACACGACAGTAACCGACACCCCCCAGGTGGTCAGTCTTCGAAGCGGGTTCAGGGCGGCAGGAAAGGAGTTCCGA
GATGGATTTTACTTCGGTATTAAGGGCCTAGGAACACAGCCGCATCATGGTCTTAAGCACGGAGGTGCTAAGGGG
CTTCTCAAAGGTGTCGGAAAAGGAATCGGTGGGTTGTTTCTCAAGCCGACAGCAGGGTTATGGGGTCTAGCAGGA
TATCCCTTAAGCGGGATAGTCAGAGAGATCAATGACTCGCTAGGCAGACATCAAAAATGCATGATTGTAATGGGT
CGAATTTCGCAAGGACTCGAAGAGATGCGAGAATCCACGGCCCAGGAAAGGGAAGAGGTATCCAGGGGATGGATT
ACTATTGAACACGACTTGAAAAAGTTGAAAACGCACCACCATTTGCATATGTCGGACTCCACTCATGCTGTGGTG
TTATTTGAGTGA
Gene >Pro_DTO377G3_2|g6477.t1
ATGGCAACTGTACTAGCACCAAATCCTGCAGAAATATCATTCGAGAGAATGGACATCAATCGCTCGGGTGATTGG
GCGAGTGAAGGTACTAAGCGAGCATCAGATGACCCCGATGGAGTGCAATTCTTCGAGGATGGGTTGAACGCCCGT
ATTCTAGGTAAAAAATGTTCCGGCAATGATCGCTGACTTTGACTAACGGGATCACGTTTTGTTGTAGGTGACGGC
CGAGTGGATATCCATATCGATCAGCATAAACCGCACCTCGGAGGGCTATTAAAGCACATCCAACGCGCGGATATA
CATTCTGAGCGAGATTCCGAATGCGCTGTCAGCGCGGAACGGCCCTACACGAATGATGAGCATTTCCCACTGCAC
TTAAACCTGGTCATCCAAGTTATTGGTTCTCGAGGCGATATTCAACCATTTGTGGCACTAGGGAAAGAACTGAAA
GCACACGGTCATCGAGTCAGATTGGCCACACATTTAGCTTTTCGGCAGTTTGTTCTCGATACCGGTCTAGAGTTC
TTCAATATCGGAGGAGACCCAGAGGAGCTGATGGCTTATATGGTCAAAAATCCGGGCCTTTTACCGGGCTTCAAG
GCAATACGCAGCGGAGATATCCAGAGGCGTCGCCGTGAGATGAAGGAAATCTTCAATGGATGTTGGAAATCTTGC
TTTGAAAAGGGTGATGGGACTTACCTTCACCAGATTAAGGAAGACCCATTCAGTAAGACAGTGGATTACCGACAG
CGGCCCTTTGTGGCGGATGCTATTATAGCAAACCCTCCTAGCCTTGCCCATATCCATTGCGCCCAACGACTGGGT
ATCCCTCTCCATATCATATTCACGTGAGCTGACTCTCTTATATAGTAATCTCTATGCACCTTTCGTATACTGAAC
ACCTAATCAATAATAGGATGCCCTGGTCACCAACCCAGTCTTTTCCCCACCCGTTAGCGAATGTCCACCGCCGGA
ACTGCAAGCCAACTATCGCAAATTTCGTGTCCTACAATATCGTCGATATGATGGTATGGGAAGGATTAGGAGATA
TTCTGAACACACTTCGCAAAAATACCTTGGCACTCCAACCCCTGGATACAATGACTGCCCCAAGCATACTACACC
GACTACATGTGCCACATACGTATATGTGGTTAGTAACATATTCCTGGTTGGCAAAAGTAGTTTAATATTTGAAAC
AGGTCCCCTTCATTACTACCTAAGCCCCCTGATTGGGCTGATAACATCGATGTATGCGGCTTTGGCTTCCTCCTC
TCAGAGACCAGCTACACACCACCAACGGAAATAGCTGCATTTCTCGACGCAGGACCAAAACCAATATACATTGGT
TTTGGCTCGATCGTAGTTGATAATGCGAACAAACTGACAAAAACCATATTTGAAGCAGTCAAAAATTCCGGACAG
CGGGCTCTTATCTCAAAAGGCTGGGGGAATTTGGGGGCAGACGAAGTGCCGGACAATATTCTGATGATTGGAAAC
TGCCCTCACGATTGGCTGTTTGGGCAGGTTTCATGTGTTATCCACCATGGTGGTGCTGGCACCACAGCGGCAGGG
CTCGCGCTAGGTCGACCGACAATAATTGTCCCTTTCTTTGGAGACCAGCAATTCTGGGGAAACATCGTTGCGCGT
GCTGGAGCTGGGCCAGCACCAATACCACATAAAATTTTGAACGTGCAGAATCTCTCAAGCGCAATCGCGAAAGCG
CTAGAGCCGAGTACTCTAGAGAGAGCACAGACGATCGCGTTGAAAATGCAGGAAGAGTCTGGTGTGCGCCATGGG
GTGAATAGCTTTCATCGAAATCTTGACCCCCAGTCATACAGATGCTCTATAGTCCCGAATCATCCGGCGGCTTGG
CATCTCAAACATACCAGAATCAACCTCAGTGCCTTTGCAGCAACGGTTCTAGTGAGATCAGGGAAGATCAGCCCA
GATATGCTCGTGCTGTAAGTCTTGCTCCACATAGTCACCACAGCTGTGAGAGTTTCTTGCTGATTCGCCTACAGT
TACCGTCCAATTGAGTATGATACATTACTGGACCCTGCCGACCCACTTACTGCTAGTGCTCAGGTGCTCTTTGGA
GTCATTACGAGCTTCGTGACTGGGCTTGTCGATGCGCCCAGAGAGATTGTGCATGATATTGTTTCTGCTGCTCGC
TCAATACGCCAACCCCATGAACATTTTGATCGCCACGCAGCATGTCAGGCAGTACTTTCTTCACCAGATCATTTA
TCTCCAGAGAATAATGATGGGACTGAAACACATATTCAAAATGAGAACGAGCAATTGCAGATTGAGAATGAGGAA
CAGCGAGATGGTGAAATCCTAGAAGGGGAGAGTGCACAGGAAGATACTACCGATGCGGACAATGAAACCGATATC
AACAGCATTGATCGAATTCGGAGCACAGAACGCAAAAGGAATATCCAGCTCGAAAAGGCCAAGACAATGAGCAGC
TCGATGACACCGACAAATCCACCTAAATCTACTATTTTACACGAAGCTGCGTTACACGGAAGTCAAATGTCCAAG
AAAATATTGAAGATAATCATAGTGGTACCGACCGATTTGACACTGAGCATGGCCAGAGGTTTCCACAACGCACCC
AAATTATATCACGACACGACAGTAACCGACACCCCCCAGGTGGTCAGTCTTCGAAGCGGGTTCAGGGCGGCAGGA
AAGGTAGTAACAGCCATACCAGCGCCAGTCTAGGGCCAAATATTCTAACATATGTACAGGAGTTCCGAGATGGAT
TTTACTTCGGTATTAAGGGCCTAGGAACACAGCCGCATCATGGTCTTAAGCACGGAGGTGCTAAGGGGCTTCTCA
AAGGTGTCGGAAAAGGAATCGGTGGGTTGTTTCTCAAGCCGACAGCAGGTATGTGGAACATGCAGGCAATGTTTC
TGTGATCTTATTGTTTACAAGCTAATCTTAATCAGGGTTATGGGGTCTAGCAGGATATCCCTTAAGCGGGATAGT
CAGAGAGATCAATGACTCGCTAGGCAGACATCAAAAATGCATGATTGTAATGGGTCGAATTTCGCAAGGACTCGA
AGAGATGCGAGAATCCACGGCCCAGGAAAGGGAAGAGGTATCCAGGGGATGGATTACTATTGAACACGACTTGAA
AAAGTTGAAAACGCACCACCATTTGCATATGTCGGACTCCACTCATGCTGTGGTGTTATTTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail