Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6458.t1
Gene name
Locationscaffold_17:248554..250883
Strand-
Gene length (bp)2329
Transcript length (bp)2151
Coding sequence length (bp)2151
Protein length (aa) 717

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05693 Glycogen_syn Glycogen synthase 0.0E+00 19 660

GO

GO Term Description Terminal node
GO:0005978 glycogen biosynthetic process Yes
GO:0004373 glycogen (starch) synthase activity Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0016740 transferase activity No
GO:0016051 carbohydrate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044042 glucan metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0016758 hexosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006112 energy reserve metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0003824 catalytic activity No
GO:0005977 glycogen metabolic process No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0044238 primary metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0009250 glucan biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0044249 cellular biosynthetic process No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:0009058 biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0034637 cellular carbohydrate biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6458.t1
MEENGEPIKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTMIGPLNRASAAVEVEELSPSNPAM
RDTIQSMKERGIDIVYGRWLIEGAPRVLLIDTGTGYRWLDEWKGDLWNTSAIPSPAGDNETNEAIVFGYLVAWFL
GEYIAHDRRRAVIAHFHEWLAGVALPLTKKRHMDLTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGI
YHRYCIERAATHACDVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAMHEFQNLHSQAKEKINDFVRGHFY
GHNDFDLDNTLYLFTAGRYEYRNKGVDMFIEGLARLNHRLKAAGSTMTVVAFIIMPAQTSSLTVEALKGQAVVKS
LRDTVENIEKGIGKRMYERCLSWKEGDNMPDEKDLITSQDRVMLRRRLFGMKRTGLPPIVTHNMVNDHEDPILNQ
LRRVQLFNHSSDRVKVIFHPEFLNSANPVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGF
GCYMEELIENSSDYGIYIVDRRSKGVDDSVNQLTEFMFNFTEKSRRQRINQRNRTERLSDLLDWKRMGLEYVKAR
QLALRRAYPSSFEGQEDYFDIIGGTEQKLSRPLSVPGSPRDRSGMMTPGDFASLQEGHEGLSTEDYIAWKLPEEE
EPEEHFPLTLRTRKMAERSSSPLDSISVNGREGSDAGYRTD*
Coding >Pro_DTO377G3_2|g6458.t1
ATGGAGGAAAATGGTGAACCCATCAAGCGTGATGTGCGCAATCACATGCTCTTCGAGGTGGCTACTGAGGTGGCG
AACCGAGTAGGCGGGATCTACTCGGTTCTCAAGTCCAAAGCGCCTGTGACCACCGCTGAGTATGGCGAGCGGTAC
ACCATGATCGGCCCTCTCAACAGGGCTTCGGCTGCTGTGGAGGTGGAAGAGCTCTCGCCGTCTAACCCGGCCATG
CGGGACACGATTCAGTCCATGAAAGAGCGCGGCATTGACATCGTCTACGGTCGCTGGCTCATCGAGGGTGCTCCC
CGAGTTCTCCTCATTGATACGGGGACTGGCTATAGGTGGCTGGACGAGTGGAAGGGTGATCTTTGGAACACCTCG
GCCATCCCGTCTCCCGCTGGTGACAATGAGACCAACGAGGCCATCGTCTTTGGATACCTGGTCGCTTGGTTCTTG
GGAGAGTACATTGCTCATGACCGTCGCCGGGCAGTCATTGCCCATTTCCATGAATGGTTGGCTGGTGTCGCTCTG
CCACTGACCAAGAAGCGGCATATGGACCTCACAACCGTCTTCACCACCCACGCGACATTATTGGGTCGTTACCTC
TGTGCTGGCTCGGTTGATTTCTATAATAACCTTCAGTACTTTGATGTGGATGCGGAGGCCGGGAAGCGAGGAATC
TACCACCGCTACTGCATTGAGCGCGCTGCTACTCATGCCTGTGATGTCTTCACCACTGTGTCGCACATCACTGCG
TTTGAGAGTGAGCACCTGCTGAAGCGCAAACCCGATGGTGTGCTGCCTAATGGTCTGAATGTCAAGAAATTCTCT
GCCATGCACGAGTTCCAGAACTTGCACTCCCAGGCCAAGGAGAAGATCAACGATTTCGTTCGTGGCCATTTCTAC
GGCCACAACGACTTCGACCTGGATAATACTCTATATCTCTTCACTGCCGGTCGTTACGAATACCGCAACAAGGGT
GTCGATATGTTCATTGAGGGGCTGGCCCGCCTCAATCATCGACTGAAGGCCGCTGGGTCAACGATGACTGTCGTC
GCGTTCATTATTATGCCCGCGCAGACCTCTTCGTTGACAGTGGAAGCGCTCAAGGGACAGGCCGTCGTCAAGTCT
CTGCGCGACACCGTCGAGAACATCGAGAAGGGGATCGGCAAGCGCATGTATGAGCGCTGCCTTTCCTGGAAGGAG
GGCGACAACATGCCCGACGAGAAAGATCTCATCACCAGTCAAGATCGTGTGATGCTCCGCCGTCGCCTGTTCGGC
ATGAAGCGCACCGGTCTGCCCCCTATCGTCACCCACAACATGGTCAATGACCACGAGGACCCAATCCTGAACCAG
CTGCGTCGCGTTCAGCTGTTCAACCACTCCTCCGACCGGGTGAAGGTTATTTTCCACCCCGAATTCCTCAACTCT
GCCAACCCCGTATTGCCGCTTGATTACGACGACTTCGTTCGCGGAACCCATCTGGGTGTCTTCCCCTCCTACTAC
GAGCCGTGGGGATACACACCGGCCGAATGTACCGTGATGGGTGTGCCTAGCATCACCACCAATCTGTCTGGATTC
GGTTGCTATATGGAGGAATTGATTGAAAACTCGTCCGATTACGGAATTTACATCGTCGACCGTCGCTCCAAGGGC
GTTGACGACTCGGTCAACCAACTGACCGAGTTTATGTTCAACTTCACGGAGAAGAGTCGTCGCCAGCGCATTAAC
CAGCGTAACCGTACGGAGCGCCTGAGCGATCTGCTCGACTGGAAAAGAATGGGCTTGGAATATGTCAAGGCTCGT
CAGCTGGCATTGAGAAGAGCTTATCCCTCCTCCTTCGAGGGCCAAGAGGACTACTTCGATATCATTGGAGGAACG
GAGCAGAAGCTCTCCCGCCCGCTTTCGGTTCCTGGATCTCCCCGGGATCGCTCCGGGATGATGACTCCCGGTGAC
TTTGCCTCTCTGCAGGAAGGCCACGAGGGATTGAGCACTGAGGATTATATTGCCTGGAAATTGCCTGAAGAGGAA
GAGCCCGAAGAGCACTTCCCCCTCACACTGCGAACCCGCAAGATGGCCGAACGCTCATCGTCCCCACTGGACAGT
ATATCGGTCAACGGCCGCGAAGGGTCCGACGCCGGATATCGGACAGACTAG
Transcript >Pro_DTO377G3_2|g6458.t1
ATGGAGGAAAATGGTGAACCCATCAAGCGTGATGTGCGCAATCACATGCTCTTCGAGGTGGCTACTGAGGTGGCG
AACCGAGTAGGCGGGATCTACTCGGTTCTCAAGTCCAAAGCGCCTGTGACCACCGCTGAGTATGGCGAGCGGTAC
ACCATGATCGGCCCTCTCAACAGGGCTTCGGCTGCTGTGGAGGTGGAAGAGCTCTCGCCGTCTAACCCGGCCATG
CGGGACACGATTCAGTCCATGAAAGAGCGCGGCATTGACATCGTCTACGGTCGCTGGCTCATCGAGGGTGCTCCC
CGAGTTCTCCTCATTGATACGGGGACTGGCTATAGGTGGCTGGACGAGTGGAAGGGTGATCTTTGGAACACCTCG
GCCATCCCGTCTCCCGCTGGTGACAATGAGACCAACGAGGCCATCGTCTTTGGATACCTGGTCGCTTGGTTCTTG
GGAGAGTACATTGCTCATGACCGTCGCCGGGCAGTCATTGCCCATTTCCATGAATGGTTGGCTGGTGTCGCTCTG
CCACTGACCAAGAAGCGGCATATGGACCTCACAACCGTCTTCACCACCCACGCGACATTATTGGGTCGTTACCTC
TGTGCTGGCTCGGTTGATTTCTATAATAACCTTCAGTACTTTGATGTGGATGCGGAGGCCGGGAAGCGAGGAATC
TACCACCGCTACTGCATTGAGCGCGCTGCTACTCATGCCTGTGATGTCTTCACCACTGTGTCGCACATCACTGCG
TTTGAGAGTGAGCACCTGCTGAAGCGCAAACCCGATGGTGTGCTGCCTAATGGTCTGAATGTCAAGAAATTCTCT
GCCATGCACGAGTTCCAGAACTTGCACTCCCAGGCCAAGGAGAAGATCAACGATTTCGTTCGTGGCCATTTCTAC
GGCCACAACGACTTCGACCTGGATAATACTCTATATCTCTTCACTGCCGGTCGTTACGAATACCGCAACAAGGGT
GTCGATATGTTCATTGAGGGGCTGGCCCGCCTCAATCATCGACTGAAGGCCGCTGGGTCAACGATGACTGTCGTC
GCGTTCATTATTATGCCCGCGCAGACCTCTTCGTTGACAGTGGAAGCGCTCAAGGGACAGGCCGTCGTCAAGTCT
CTGCGCGACACCGTCGAGAACATCGAGAAGGGGATCGGCAAGCGCATGTATGAGCGCTGCCTTTCCTGGAAGGAG
GGCGACAACATGCCCGACGAGAAAGATCTCATCACCAGTCAAGATCGTGTGATGCTCCGCCGTCGCCTGTTCGGC
ATGAAGCGCACCGGTCTGCCCCCTATCGTCACCCACAACATGGTCAATGACCACGAGGACCCAATCCTGAACCAG
CTGCGTCGCGTTCAGCTGTTCAACCACTCCTCCGACCGGGTGAAGGTTATTTTCCACCCCGAATTCCTCAACTCT
GCCAACCCCGTATTGCCGCTTGATTACGACGACTTCGTTCGCGGAACCCATCTGGGTGTCTTCCCCTCCTACTAC
GAGCCGTGGGGATACACACCGGCCGAATGTACCGTGATGGGTGTGCCTAGCATCACCACCAATCTGTCTGGATTC
GGTTGCTATATGGAGGAATTGATTGAAAACTCGTCCGATTACGGAATTTACATCGTCGACCGTCGCTCCAAGGGC
GTTGACGACTCGGTCAACCAACTGACCGAGTTTATGTTCAACTTCACGGAGAAGAGTCGTCGCCAGCGCATTAAC
CAGCGTAACCGTACGGAGCGCCTGAGCGATCTGCTCGACTGGAAAAGAATGGGCTTGGAATATGTCAAGGCTCGT
CAGCTGGCATTGAGAAGAGCTTATCCCTCCTCCTTCGAGGGCCAAGAGGACTACTTCGATATCATTGGAGGAACG
GAGCAGAAGCTCTCCCGCCCGCTTTCGGTTCCTGGATCTCCCCGGGATCGCTCCGGGATGATGACTCCCGGTGAC
TTTGCCTCTCTGCAGGAAGGCCACGAGGGATTGAGCACTGAGGATTATATTGCCTGGAAATTGCCTGAAGAGGAA
GAGCCCGAAGAGCACTTCCCCCTCACACTGCGAACCCGCAAGATGGCCGAACGCTCATCGTCCCCACTGGACAGT
ATATCGGTCAACGGCCGCGAAGGGTCCGACGCCGGATATCGGACAGACTAG
Gene >Pro_DTO377G3_2|g6458.t1
ATGGAGGAAAATGGTGAACCCATCAAGCGTGATGTGCGCAATCACATGCTCTTCGAGGTGGCTACTGAGGTGGCG
AACCGAGTAGGCGGGATCTACTCGGTTCTCAAGTCCAAAGCGCCTGTGACCACCGCTGAGTATGGCGAGCGGTAC
ACCATGATCGGCCCTCTCAACAGGGCTTCGGCTGCTGTGGAGGTGGAAGAGCTCTCGCCGTCTAACCCGGCCATG
CGGGACACGATTCAGTCCATGAAAGAGCGCGGCATTGACATCGTCTACGGTCGCTGGCTCATCGAGGGTGCTCCC
CGAGTTCTCCTCATTGATACGGGGACTGGCTATAGGTGGCTGGACGAGTGGAAGGGTGATCTTTGGAACACCTCG
GCCATCCCGTCTCCCGCTGGTGACAATGAGACCAACGAGGCCATCGTCTTTGGATACCTGGTCGCTTGGTTCTTG
GGAGAGGTACGTACCAGCAATATTGTCTACGTTGGAGATGGCAAAAGTGCATGACTGACCATGCTCTCGCTGTAG
TACATTGCTCATGACCGTCGCCGGGCAGTCATTGCCCATTTCCATGAATGGTTGGCTGGTGTCGCTCTGCCACTG
ACCAAGAAGCGGCATATGGACCTCACAACCGTCTTCACCACCCACGCGACATTATTGGGTCGTTACCTCTGTGCT
GGCTCGGTTGATTTCTATAATAACCTTCAGTACTTTGATGTGGATGCGGAGGCCGGGAAGCGAGGAATCTACCAC
CGCTACTGCATTGAGCGCGCTGCTACTCATGCCTGTGATGTCTTCACCACTGTGTCGCACATCACTGCGTTTGAG
AGTGAGCACCTGCTGAAGCGCAAACCCGATGGTGTGCTGCCTAATGGTCTGAATGTCAAGAAATTCTCTGCCATG
CACGAGTTCCAGAACTTGCACTCCCAGGCCAAGGAGAAGATCAACGATTTCGTTCGTGGCCATTTCTACGGCCAC
AACGACTTCGACCTGGATAATACTCTATATCTCTTCACTGCCGGTCGTTACGAATACCGCAACAAGGGTGTCGAT
ATGTTCATTGAGGGGCTGGCCCGCCTCAATCATCGACTGAAGGCCGCTGGGTCAACGATGACTGTCGTCGCGTTC
ATTATTATGCCCGCGCAGACCTCTTCGTTGACAGTGGAAGCGCTCAAGGGACAGGCCGTCGTCAAGTCTCTGCGC
GACACCGTCGAGAACATCGAGAAGGGGATCGGCAAGCGCATGTATGAGCGCTGCCTTTCCTGGAAGGAGGGCGAC
AACATGCCCGACGAGAAAGATCTCATCACCAGTCAAGATCGTGTGATGCTCCGCCGTCGCCTGTTCGGCATGAAG
CGCACCGGTCTGCCCCCTATCGTCACCCACAACATGGTCAATGACCACGAGGACCCAATCCTGAACCAGCTGCGT
CGCGTTCAGCTGTTCAACCACTCCTCCGACCGGGTGAAGGTTATTTTCCACCCCGAATTCCTCAACTCTGCCAAC
CCCGTATTGCCGCTTGATTACGACGACTTCGTTCGCGGAACCCATCTGGGTGTCTTCCCCTCCTACTACGAGCCG
TGGGGATACACACCGGCCGAATGTACCGTGATGGGTGTGCCTAGCATCACCACCAATCTGTCTGGATTCGGTTGC
TATATGGAGGAATTGATTGAAAACTCGTCCGATTACGGAATTTACATCGTCGACCGTCGCTCCAAGGGCGTTGAC
GACTCGGTCAACCAACTGACCGAGTTTATGTTCAACTTCACGGAGAAGAGTCGTCGCCAGCGCATTAACCAGCGT
AACCGTACGGAGCGCCTGAGCGATCTGCTCGACTGGAAAAGAATGGGCTTGGAATATGTCAAGGCTCGTCAGCTG
GCATTGAGAAGAGGTATGTTGCAGTTCGTTTTTGTGTTGTCGGTGATTATGATTAATTCTTTTTTTTTACAGCTT
ATCCCTCCTCCTTCGAGGGCCAAGAGGACTACTTCGATATCATTGGAGGAACGGAGCAGAAGCTCTCCCGCCCGC
TTTCGGTTCCTGGATCTCCCCGGGATCGCTCCGGGATGATGACTCCCGGTGACTTTGCCTCTCTGCAGGAAGGCC
ACGAGGGATTGAGCACTGAGGATTATATTGCCTGGAAATTGCCGTAAGTTCCATTGTATGATTGATGTTGTCAAA
TACTAATACATTCCATAGTGAAGAGGAAGAGCCCGAAGAGCACTTCCCCCTCACACTGCGAACCCGCAAGATGGC
CGAACGCTCATCGTCCCCACTGGACAGTATATCGGTCAACGGCCGCGAAGGGTCCGACGCCGGATATCGGACAGA
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail