Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6452.t1
Gene name
Locationscaffold_17:235025..238235
Strand-
Gene length (bp)3210
Transcript length (bp)3051
Coding sequence length (bp)3051
Protein length (aa) 1017

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 1.1E-08 187 225
PF00122 E1-E2_ATPase E1-E2 ATPase 5.9E-22 299 434
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.3E-17 451 717
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 9.1E-08 90 142

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 365 387 22
2 400 422 22
3 763 785 22
4 792 811 19
5 826 848 22
6 890 912 22
7 938 960 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6452.t1
MSGDGQAERAETRRRSSRISRASLSGDYNSLDEYGKLVKYVSTFRDAAADQQQGELVEKRVWYAPWKKHQVRVKK
VEGEVGKFPDDWTMTDVREGLSSHEVPIRRRRAGWNEMTSEKENPIAKILSYFQGPILYVMELAVLLAAGLEDWI
DFGVIIGILCLNAAVGWYQEKQAADIVASLKGDIALRAQVIRDSTQQECLARELVPGDVVIVGEGQVVPADSRVI
CDVKDEHGWEEFNQLQEQGMLGGGSESDEEEDPTNTDKGKGEDGEGGEGEIKAKEKDEHQAKKARRRGYPILACD
HSAITGESLAVDRYMGDMIFYTTGCKRGKAYAVVQTPATTSFVGRTATMVQSAKGAGHFELVMDNIGTSLLILVM
AWILAAWIGGFFRHIPIASPGQQTLLHYTLSLLIIGVPVGLPVVTTTTMAVGAAYLAKKKAIVQKLTAIESLAGV
DILCSDKTGTLTANKLSIRDPYVAEGVDVDWMFAVAALASSHNIESLDPIDKVTILALRQYPRAREILRRGWSTE
TFTPFDPVSKRIVTIATCDGIRYTCTKGAPKAVLQLTSCSKETADLYKAKAQEFAHRGFRSLGIAVQKEGEDWAL
LGMLPMFDPPREDTAQTISEAQNLGISVKMLTGDAIAIAKETCKMLALGTKVYNSDKLIHGGLSGAMASDLVEKA
DGFAEVFPEHKYQVVQMLQERGHLTAMTGDGVNDAPSLKKADCGIAVEGASEAAQSAADIVFLEPGLSTIIDSIK
VARQIFHRMKSYIQYRIALCLHLEIYLVTSMIILNESIRVELIVFLALFADLATVAVAYDHASFELRPVEWQLPK
IWVISCLLGVLLAMGTWVIRGSMFLKNGGIIQNWGSIQEVLFLEVALTENWLIFVTRGIDTWPSIHLVVAILGVD
ALATIYCLFGWFTNQTMPTKPADHFVETTNGWTDIVTVIRIWGYSLGVSIVIALVYFILNKIEWLDNLGRSKRDK
GEIRIENLLAHLSRVTVEYEESGATKGRFSLATTKEEEEAE*
Coding >Pro_DTO377G3_2|g6452.t1
ATGTCCGGCGACGGTCAAGCCGAACGTGCCGAGACTCGCCGCCGGAGCTCACGTATCTCCCGGGCATCTCTGAGC
GGGGACTACAACAGTCTGGACGAGTATGGCAAGCTTGTCAAGTACGTTTCGACGTTCCGGGATGCTGCGGCGGAT
CAACAACAGGGCGAATTGGTCGAGAAACGAGTCTGGTATGCCCCGTGGAAGAAGCATCAGGTCCGCGTCAAAAAG
GTCGAGGGGGAGGTTGGCAAGTTTCCCGATGATTGGACCATGACGGATGTCCGAGAGGGGCTTTCTAGCCATGAA
GTGCCAATCCGTCGGCGTCGGGCTGGTTGGAACGAGATGACATCCGAGAAGGAAAATCCTATTGCTAAGATTCTT
TCTTACTTCCAAGGACCAATTCTCTACGTCATGGAATTGGCTGTTCTGCTTGCTGCTGGTCTAGAGGACTGGATT
GATTTTGGTGTGATCATTGGTATCCTGTGTCTGAACGCGGCAGTGGGCTGGTATCAGGAGAAGCAGGCTGCGGAT
ATTGTTGCGAGTCTCAAGGGTGATATTGCCCTGCGTGCGCAGGTCATTCGTGACAGTACTCAACAAGAATGTCTT
GCTCGGGAGTTGGTTCCAGGCGATGTAGTCATCGTCGGTGAAGGTCAAGTCGTGCCTGCGGACTCCAGAGTCATC
TGTGATGTCAAGGATGAACATGGCTGGGAAGAGTTCAACCAGCTTCAAGAGCAGGGTATGCTCGGTGGAGGGTCC
GAGTCTGATGAAGAGGAAGACCCAACCAATACCGATAAGGGTAAGGGCGAAGACGGAGAAGGCGGAGAAGGCGAG
ATCAAGGCCAAGGAAAAAGACGAACACCAGGCGAAGAAGGCTCGCAGACGTGGCTATCCTATTTTAGCTTGTGAT
CACTCTGCTATCACGGGCGAGTCGCTAGCTGTGGATCGTTACATGGGAGATATGATCTTCTATACAACTGGCTGT
AAGCGTGGCAAGGCCTATGCTGTCGTTCAAACGCCTGCGACCACTTCCTTCGTTGGCCGCACTGCAACTATGGTG
CAATCTGCTAAAGGCGCTGGTCACTTCGAACTTGTCATGGACAATATTGGAACATCTCTCTTGATTCTCGTTATG
GCCTGGATCCTTGCTGCATGGATCGGTGGATTCTTCCGTCATATTCCTATCGCTTCACCTGGTCAGCAGACTTTG
CTTCACTACACTCTGTCTTTGTTGATCATTGGTGTACCTGTCGGTTTACCTGTTGTGACCACTACCACCATGGCT
GTCGGTGCTGCCTATCTGGCAAAGAAGAAAGCTATTGTGCAAAAGCTGACTGCAATTGAATCCCTGGCCGGTGTC
GATATTCTGTGTTCGGATAAGACGGGTACACTCACGGCAAACAAACTGAGTATTCGTGATCCTTATGTAGCTGAA
GGCGTCGACGTGGACTGGATGTTTGCCGTTGCTGCTCTCGCGTCATCGCACAATATTGAATCTCTCGATCCGATT
GATAAAGTGACAATTTTGGCGCTTAGACAATATCCAAGAGCACGAGAAATCCTGCGACGGGGTTGGTCAACCGAA
ACTTTCACGCCCTTTGACCCGGTTTCAAAACGCATTGTCACTATTGCCACCTGTGACGGTATTCGGTATACCTGC
ACCAAAGGCGCTCCGAAAGCCGTGCTTCAATTGACAAGCTGCTCTAAGGAGACAGCTGACTTATACAAGGCCAAA
GCCCAAGAATTTGCGCATCGAGGCTTCCGCTCTCTCGGTATTGCTGTTCAGAAAGAAGGCGAAGATTGGGCTCTG
CTTGGAATGCTCCCTATGTTTGATCCGCCCCGAGAAGATACCGCTCAAACTATCAGCGAAGCGCAGAATCTCGGT
ATTAGCGTGAAGATGCTTACCGGTGATGCTATTGCTATTGCGAAAGAAACCTGCAAGATGTTGGCTTTGGGTACT
AAGGTGTATAACTCAGACAAGCTAATCCACGGCGGTTTGAGCGGTGCCATGGCTAGTGATCTCGTTGAAAAAGCA
GACGGCTTTGCCGAAGTGTTCCCGGAACACAAATACCAAGTCGTACAAATGCTACAAGAACGAGGGCACTTGACC
GCTATGACCGGCGATGGTGTAAATGACGCACCATCTCTCAAAAAAGCCGATTGTGGCATCGCCGTCGAAGGTGCC
TCGGAAGCCGCTCAGTCCGCAGCAGACATCGTGTTCCTCGAGCCTGGTCTTTCAACTATCATTGACTCTATTAAG
GTCGCACGTCAAATCTTTCACCGCATGAAGTCATATATTCAATACCGCATTGCACTCTGCTTGCACCTTGAGATC
TACCTCGTGACTTCGATGATCATCCTCAATGAAAGCATCCGTGTGGAGCTTATTGTCTTCCTGGCATTGTTCGCC
GATCTTGCGACCGTTGCAGTTGCCTATGACCATGCATCATTCGAGCTGCGACCTGTGGAATGGCAACTTCCCAAA
ATCTGGGTCATTTCCTGCCTTCTTGGTGTGCTTCTCGCCATGGGTACGTGGGTTATCCGAGGAAGTATGTTCCTG
AAGAACGGAGGCATTATCCAAAACTGGGGATCTATTCAAGAGGTCCTCTTTTTGGAAGTGGCACTCACAGAGAAT
TGGCTAATTTTCGTCACTCGCGGCATCGACACATGGCCATCAATCCACCTGGTAGTCGCTATCCTCGGCGTCGAC
GCTTTGGCTACGATCTACTGTCTGTTCGGTTGGTTTACCAACCAAACCATGCCAACCAAGCCCGCAGACCATTTT
GTTGAGACCACAAATGGCTGGACCGATATCGTCACTGTTATTCGAATCTGGGGTTATTCGCTTGGTGTTTCGATT
GTTATCGCTCTAGTATACTTCATCTTGAACAAGATTGAGTGGCTCGATAATCTGGGTCGTTCCAAGCGCGACAAG
GGTGAGATCAGAATTGAGAACCTGCTTGCTCACTTGTCTCGTGTTACGGTTGAGTACGAGGAATCGGGCGCCACG
AAGGGCCGGTTCTCCTTGGCTACAACCAAGGAGGAGGAGGAGGCTGAGTGA
Transcript >Pro_DTO377G3_2|g6452.t1
ATGTCCGGCGACGGTCAAGCCGAACGTGCCGAGACTCGCCGCCGGAGCTCACGTATCTCCCGGGCATCTCTGAGC
GGGGACTACAACAGTCTGGACGAGTATGGCAAGCTTGTCAAGTACGTTTCGACGTTCCGGGATGCTGCGGCGGAT
CAACAACAGGGCGAATTGGTCGAGAAACGAGTCTGGTATGCCCCGTGGAAGAAGCATCAGGTCCGCGTCAAAAAG
GTCGAGGGGGAGGTTGGCAAGTTTCCCGATGATTGGACCATGACGGATGTCCGAGAGGGGCTTTCTAGCCATGAA
GTGCCAATCCGTCGGCGTCGGGCTGGTTGGAACGAGATGACATCCGAGAAGGAAAATCCTATTGCTAAGATTCTT
TCTTACTTCCAAGGACCAATTCTCTACGTCATGGAATTGGCTGTTCTGCTTGCTGCTGGTCTAGAGGACTGGATT
GATTTTGGTGTGATCATTGGTATCCTGTGTCTGAACGCGGCAGTGGGCTGGTATCAGGAGAAGCAGGCTGCGGAT
ATTGTTGCGAGTCTCAAGGGTGATATTGCCCTGCGTGCGCAGGTCATTCGTGACAGTACTCAACAAGAATGTCTT
GCTCGGGAGTTGGTTCCAGGCGATGTAGTCATCGTCGGTGAAGGTCAAGTCGTGCCTGCGGACTCCAGAGTCATC
TGTGATGTCAAGGATGAACATGGCTGGGAAGAGTTCAACCAGCTTCAAGAGCAGGGTATGCTCGGTGGAGGGTCC
GAGTCTGATGAAGAGGAAGACCCAACCAATACCGATAAGGGTAAGGGCGAAGACGGAGAAGGCGGAGAAGGCGAG
ATCAAGGCCAAGGAAAAAGACGAACACCAGGCGAAGAAGGCTCGCAGACGTGGCTATCCTATTTTAGCTTGTGAT
CACTCTGCTATCACGGGCGAGTCGCTAGCTGTGGATCGTTACATGGGAGATATGATCTTCTATACAACTGGCTGT
AAGCGTGGCAAGGCCTATGCTGTCGTTCAAACGCCTGCGACCACTTCCTTCGTTGGCCGCACTGCAACTATGGTG
CAATCTGCTAAAGGCGCTGGTCACTTCGAACTTGTCATGGACAATATTGGAACATCTCTCTTGATTCTCGTTATG
GCCTGGATCCTTGCTGCATGGATCGGTGGATTCTTCCGTCATATTCCTATCGCTTCACCTGGTCAGCAGACTTTG
CTTCACTACACTCTGTCTTTGTTGATCATTGGTGTACCTGTCGGTTTACCTGTTGTGACCACTACCACCATGGCT
GTCGGTGCTGCCTATCTGGCAAAGAAGAAAGCTATTGTGCAAAAGCTGACTGCAATTGAATCCCTGGCCGGTGTC
GATATTCTGTGTTCGGATAAGACGGGTACACTCACGGCAAACAAACTGAGTATTCGTGATCCTTATGTAGCTGAA
GGCGTCGACGTGGACTGGATGTTTGCCGTTGCTGCTCTCGCGTCATCGCACAATATTGAATCTCTCGATCCGATT
GATAAAGTGACAATTTTGGCGCTTAGACAATATCCAAGAGCACGAGAAATCCTGCGACGGGGTTGGTCAACCGAA
ACTTTCACGCCCTTTGACCCGGTTTCAAAACGCATTGTCACTATTGCCACCTGTGACGGTATTCGGTATACCTGC
ACCAAAGGCGCTCCGAAAGCCGTGCTTCAATTGACAAGCTGCTCTAAGGAGACAGCTGACTTATACAAGGCCAAA
GCCCAAGAATTTGCGCATCGAGGCTTCCGCTCTCTCGGTATTGCTGTTCAGAAAGAAGGCGAAGATTGGGCTCTG
CTTGGAATGCTCCCTATGTTTGATCCGCCCCGAGAAGATACCGCTCAAACTATCAGCGAAGCGCAGAATCTCGGT
ATTAGCGTGAAGATGCTTACCGGTGATGCTATTGCTATTGCGAAAGAAACCTGCAAGATGTTGGCTTTGGGTACT
AAGGTGTATAACTCAGACAAGCTAATCCACGGCGGTTTGAGCGGTGCCATGGCTAGTGATCTCGTTGAAAAAGCA
GACGGCTTTGCCGAAGTGTTCCCGGAACACAAATACCAAGTCGTACAAATGCTACAAGAACGAGGGCACTTGACC
GCTATGACCGGCGATGGTGTAAATGACGCACCATCTCTCAAAAAAGCCGATTGTGGCATCGCCGTCGAAGGTGCC
TCGGAAGCCGCTCAGTCCGCAGCAGACATCGTGTTCCTCGAGCCTGGTCTTTCAACTATCATTGACTCTATTAAG
GTCGCACGTCAAATCTTTCACCGCATGAAGTCATATATTCAATACCGCATTGCACTCTGCTTGCACCTTGAGATC
TACCTCGTGACTTCGATGATCATCCTCAATGAAAGCATCCGTGTGGAGCTTATTGTCTTCCTGGCATTGTTCGCC
GATCTTGCGACCGTTGCAGTTGCCTATGACCATGCATCATTCGAGCTGCGACCTGTGGAATGGCAACTTCCCAAA
ATCTGGGTCATTTCCTGCCTTCTTGGTGTGCTTCTCGCCATGGGTACGTGGGTTATCCGAGGAAGTATGTTCCTG
AAGAACGGAGGCATTATCCAAAACTGGGGATCTATTCAAGAGGTCCTCTTTTTGGAAGTGGCACTCACAGAGAAT
TGGCTAATTTTCGTCACTCGCGGCATCGACACATGGCCATCAATCCACCTGGTAGTCGCTATCCTCGGCGTCGAC
GCTTTGGCTACGATCTACTGTCTGTTCGGTTGGTTTACCAACCAAACCATGCCAACCAAGCCCGCAGACCATTTT
GTTGAGACCACAAATGGCTGGACCGATATCGTCACTGTTATTCGAATCTGGGGTTATTCGCTTGGTGTTTCGATT
GTTATCGCTCTAGTATACTTCATCTTGAACAAGATTGAGTGGCTCGATAATCTGGGTCGTTCCAAGCGCGACAAG
GGTGAGATCAGAATTGAGAACCTGCTTGCTCACTTGTCTCGTGTTACGGTTGAGTACGAGGAATCGGGCGCCACG
AAGGGCCGGTTCTCCTTGGCTACAACCAAGGAGGAGGAGGAGGCTGAGTGA
Gene >Pro_DTO377G3_2|g6452.t1
ATGTCCGGCGACGGTCAAGCCGAACGTGCCGAGACTCGCCGCCGGAGCTCACGTATCTCCCGGGCATCTCTGAGC
GGGGACTACAACAGTCTGGACGAGTATGGCAAGCTTGTCAAGTACGTTTCGACGTTCCGGGATGCTGCGGCGGAT
CAACAACAGGGCGAATTGGTCGAGAAACGAGTCTGGTATGCCCCGTGGAAGAAGCATCAGGTCCGCGTCAAAAAG
GTCGAGGGGGAGGTTGGCAAGTTTCCCGATGATTGGACCATGACGGATGTCCGAGAGGGGCTTTCTAGCCATGAA
GTGCCAATCCGTCGGCGTCGGGCTGGTTGGAACGAGATGACATCCGAGAAGGAAAATCCTATTGCTAAGATTCTT
TCTTACTTCCAAGGACCAATTCTCTACGGTGAGTGCATATAACTCCTCCCTTGGTTACCGCACTGACTGGAGCAT
AGTCATGGAATTGGCTGTTCTGCTTGCTGCTGGTCTAGAGGACTGGATTGATTTTGGTGTGATCATTGGTATCCT
GTGTCTGAACGCGGCAGTGGGCTGGTATCAGGAGAAGCAGGCTGCGGATATTGTTGCGAGTCTCAAGGGTGATAT
TGCCCTGCGTGCGCAGGTCATTCGTGACAGTACTCAACAAGAATGTCTTGCTCGGGAGTTGGTTCCAGGCGATGT
AGTAAGTCTATTTTGGATGAGCTGGAACATTGGTATACGCAAACTTCTTATCAATCATTTAGGTCATCGTCGGTG
AAGGTCAAGTCGTGCCTGCGGACTCCAGAGTCATCTGTGATGTCAAGGATGAACATGGCTGGGAAGAGTTCAACC
AGCTTCAAGAGCAGGGTATGCTCGGTGGAGGGTCCGAGTCTGATGAAGAGGAAGACCCAACCAATACCGATAAGG
GTAAGGGCGAAGACGGAGAAGGCGGAGAAGGCGAGATCAAGGCCAAGGAAAAAGACGAACACCAGGCGAAGAAGG
CTCGCAGACGTGGCTATCCTATTTTAGCTTGTGATCACTCTGCTATCACGGGCGAGTCGCTAGCTGTGGATCGTT
ACATGGGAGATATGATCTTCTATACAACTGGCTGTAAGCGTGGCAAGGCCTATGCTGTCGTTCAAACGCCTGCGA
CCACTTCCTTCGTTGGCCGCACTGCAACTATGGTGCAATCTGCTAAAGGCGCTGGTCACTTCGAACTTGTCATGG
ACAATATTGGAACATCTCTCTTGATTCTCGTTATGGCCTGGATCCTTGCTGCATGGATCGGTGGATTCTTCCGTC
ATATTCCTATCGCTTCACCTGGTCAGCAGACTTTGCTTCACTACACTCTGTCTTTGTTGATCATTGGTGTACCTG
TCGGTTTACCTGTTGTGACCACTACCACCATGGCTGTCGGTGCTGCCTATCTGGCAAAGAAGAAAGCTATTGTGC
AAAAGCTGACTGCAATTGAATCCCTGGCCGTAAGTCTGCGTCAAATTGGACTATTATGAGATACTGACAGCGAAT
TAGGGTGTCGATATTCTGTGTTCGGATAAGACGGGTACACTCACGGCAAACAAACTGAGTATTCGTGATCCTTAT
GTAGCTGAAGGCGTCGACGTGGACTGGATGTTTGCCGTTGCTGCTCTCGCGTCATCGCACAATATTGAATCTCTC
GATCCGATTGATAAAGTGACAATTTTGGCGCTTAGACAATATCCAAGAGCACGAGAAATCCTGCGACGGGGTTGG
TCAACCGAAACTTTCACGCCCTTTGACCCGGTTTCAAAACGCATTGTCACTATTGCCACCTGTGACGGTATTCGG
TATACCTGCACCAAAGGCGCTCCGAAAGCCGTGCTTCAATTGACAAGCTGCTCTAAGGAGACAGCTGACTTATAC
AAGGCCAAAGCCCAAGAATTTGCGCATCGAGGCTTCCGCTCTCTCGGTATTGCTGTTCAGAAAGAAGGCGAAGAT
TGGGCTCTGCTTGGAATGCTCCCTATGTTTGATCCGCCCCGAGAAGATACCGCTCAAACTATCAGCGAAGCGCAG
AATCTCGGTATTAGCGTGAAGATGCTTACCGGTGATGCTATTGCTATTGCGAAAGAAACCTGCAAGATGTTGGCT
TTGGGTACTAAGGTGTATAACTCAGACAAGCTAATCCACGGCGGTTTGAGCGGTGCCATGGCTAGTGATCTCGTT
GAAAAAGCAGACGGCTTTGCCGAAGTGTTCCCGGAACACAAATACCAAGTCGTACAAATGCTACAAGAACGAGGG
CACTTGACCGCTATGACCGGCGATGGTGTAAATGACGCACCATCTCTCAAAAAAGCCGATTGTGGCATCGCCGTC
GAAGGTGCCTCGGAAGCCGCTCAGTCCGCAGCAGACATCGTGTTCCTCGAGCCTGGTCTTTCAACTATCATTGAC
TCTATTAAGGTCGCACGTCAAATCTTTCACCGCATGAAGTCATATATTCAATACCGCATTGCACTCTGCTTGCAC
CTTGAGATCTACCTCGTGACTTCGATGATCATCCTCAATGAAAGCATCCGTGTGGAGCTTATTGTCTTCCTGGCA
TTGTTCGCCGATCTTGCGACCGTTGCAGTTGCCTATGACCATGCATCATTCGAGCTGCGACCTGTGGAATGGCAA
CTTCCCAAAATCTGGGTCATTTCCTGCCTTCTTGGTGTGCTTCTCGCCATGGGTACGTGGGTTATCCGAGGAAGT
ATGTTCCTGAAGAACGGAGGCATTATCCAAAACTGGGGATCTATTCAAGAGGTCCTCTTTTTGGAAGTGGCACTC
ACAGAGAATTGGCTAATTTTCGTCACTCGCGGCATCGACACATGGCCATCAATCCACCTGGTAGTCGCTATCCTC
GGCGTCGACGCTTTGGCTACGATCTACTGTCTGTTCGGTTGGTTTACCAACCAAACCATGCCAACCAAGCCCGCA
GACCATTTTGTTGAGACCACAAATGGCTGGACCGATATCGTCACTGTTATTCGAATCTGGGGTTATTCGCTTGGT
GTTTCGATTGTTATCGCTCTAGTATACTTCATCTTGAACAAGATTGAGTGGCTCGATAATCTGGGTCGTTCCAAG
CGCGACAAGGGTGAGATCAGAATTGAGAACCTGCTTGCTCACTTGTCTCGTGTTACGGTTGAGTACGAGGAATCG
GGCGCCACGAAGGGCCGGTTCTCCTTGGCTACAACCAAGGAGGAGGAGGAGGCTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail