Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6449.t1
Gene name
Locationscaffold_17:227885..228976
Strand+
Gene length (bp)1091
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 8.6E-05 27 65
PF04193 PQ-loop PQ loop repeat 1.1E-13 154 206

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 68 87 19
3 128 147 19
4 152 174 22
5 184 206 22
6 213 235 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6449.t1
MSLFQAAFDYAAPVFLISSPVTSYADQIFSIHRSRSSAGFSLDIPLIMLISSILKIFFWFGEYYSRTLLTQAIVM
IVVQITMLKVALDNRPSAGVRNGIEHTPFSGGNSDGSSSRPYEFWQWKATKPYWMCLAYFVGMLTIIHLTPVAQS
RFYISLLGYIGLAVEAILPIPQILANHQSGSCKGFRFSVIAAWILGDTMKMSYFFNSTETIPWAFKLCGIFQCVC
DFYLGFQFYFFTRNTPSKTPSHSLSNSLSNSFAIPHSHSNSLSHNFPVSDSHSRSNSQAASESMENDRWGHHEKD
IRMD*
Coding >Pro_DTO377G3_2|g6449.t1
ATGTCTCTTTTCCAGGCCGCCTTTGACTATGCCGCACCTGTCTTCCTTATAAGCTCTCCGGTCACATCCTATGCC
GACCAAATCTTCAGCATTCATCGCTCAAGAAGCTCGGCGGGCTTCTCCTTAGACATTCCTTTGATTATGCTGATC
TCGTCGATTCTGAAGATTTTCTTTTGGTTCGGCGAGTACTACTCAAGGACTTTGTTAACGCAAGCAATTGTCATG
ATCGTGGTGCAGATCACGATGCTCAAGGTTGCACTCGATAATCGGCCCTCTGCCGGGGTGAGAAATGGAATTGAG
CACACACCCTTCAGCGGCGGTAACTCCGATGGTTCATCCTCAAGACCTTATGAGTTCTGGCAGTGGAAGGCTACC
AAGCCATATTGGATGTGTCTAGCCTACTTCGTCGGAATGTTGACCATCATCCACCTTACCCCGGTCGCTCAATCG
CGATTCTATATCAGCCTCCTTGGCTACATCGGACTCGCCGTCGAAGCTATCCTCCCTATCCCTCAAATCCTCGCC
AACCACCAATCCGGCTCGTGCAAGGGCTTCCGATTCTCCGTTATTGCGGCATGGATTCTCGGTGACACTATGAAA
ATGAGTTACTTCTTCAACAGCACAGAGACCATCCCCTGGGCGTTCAAGCTCTGTGGTATCTTCCAGTGTGTGTGC
GACTTCTACCTGGGCTTCCAGTTCTACTTCTTCACTCGCAACACCCCATCTAAAACACCATCCCACTCGCTCTCC
AACTCGCTCTCTAACTCGTTTGCTATCCCACACTCACACTCCAACTCACTCTCGCACAATTTCCCTGTCTCCGAT
TCTCACTCCCGCTCCAACTCCCAGGCTGCAAGCGAGTCTATGGAGAATGACCGCTGGGGTCATCACGAGAAGGAC
ATCCGCATGGACTGA
Transcript >Pro_DTO377G3_2|g6449.t1
ATGTCTCTTTTCCAGGCCGCCTTTGACTATGCCGCACCTGTCTTCCTTATAAGCTCTCCGGTCACATCCTATGCC
GACCAAATCTTCAGCATTCATCGCTCAAGAAGCTCGGCGGGCTTCTCCTTAGACATTCCTTTGATTATGCTGATC
TCGTCGATTCTGAAGATTTTCTTTTGGTTCGGCGAGTACTACTCAAGGACTTTGTTAACGCAAGCAATTGTCATG
ATCGTGGTGCAGATCACGATGCTCAAGGTTGCACTCGATAATCGGCCCTCTGCCGGGGTGAGAAATGGAATTGAG
CACACACCCTTCAGCGGCGGTAACTCCGATGGTTCATCCTCAAGACCTTATGAGTTCTGGCAGTGGAAGGCTACC
AAGCCATATTGGATGTGTCTAGCCTACTTCGTCGGAATGTTGACCATCATCCACCTTACCCCGGTCGCTCAATCG
CGATTCTATATCAGCCTCCTTGGCTACATCGGACTCGCCGTCGAAGCTATCCTCCCTATCCCTCAAATCCTCGCC
AACCACCAATCCGGCTCGTGCAAGGGCTTCCGATTCTCCGTTATTGCGGCATGGATTCTCGGTGACACTATGAAA
ATGAGTTACTTCTTCAACAGCACAGAGACCATCCCCTGGGCGTTCAAGCTCTGTGGTATCTTCCAGTGTGTGTGC
GACTTCTACCTGGGCTTCCAGTTCTACTTCTTCACTCGCAACACCCCATCTAAAACACCATCCCACTCGCTCTCC
AACTCGCTCTCTAACTCGTTTGCTATCCCACACTCACACTCCAACTCACTCTCGCACAATTTCCCTGTCTCCGAT
TCTCACTCCCGCTCCAACTCCCAGGCTGCAAGCGAGTCTATGGAGAATGACCGCTGGGGTCATCACGAGAAGGAC
ATCCGCATGGACTGA
Gene >Pro_DTO377G3_2|g6449.t1
ATGTCTCTTTTCCAGGCCGCCTTTGACTATGCCGCACCTGTCTTGTACGTGGTCGTAAATGACTGACCCACGGGT
TCCCAGTGCTAATCATGCTCGTGTGCAGCCTTATAAGCTCTCCGGTCACATCCTATGCCGACCAAATCTTCAGCA
TTCATCGCTCAAGAAGCTCGGCGGGCTTCTCCTTAGACATTCCTTTGATTATGCTGATCTCGTCGATTCTGAAGT
AAGATTCCGATCGGCAGCGGGTTGATATTCGAGGCGGCAGTTCCATGTTAACATTATTAGGATTTTCTTTTGGTT
CGGCGAGTACTACTCAAGGACTTTGTTAACGCAAGCAATTGTCATGATCGTGGTGCAGATCACGATGCTCAAGGT
TGCACTCGATAATCGGCCCTCTGCCGGGGTGAGAAATGGAATTGAGCACACACCCTTCAGCGGCGGTAACTCCGA
TGGTTCATCCTCAAGACCTTATGAGTTCTGGCAGTGGAAGGCTACCAAGCCGTAAGTCTCGGCATCTCCAACCAC
TGCGATCAAAGCTGATTACCCATTTTCGAAGATATTGGATGTGTCTAGCCTACTTCGTCGGAATGTTGACCATCA
TCCACCTTACCCCGGTCGCTCAATCGCGATTCTATATCAGCCTCCTTGGCTACATCGGACTCGCCGTCGAAGCTA
TCCTCCCTATCCCTCAAATCCTCGCCAACCACCAATCCGGCTCGTGCAAGGGCTTCCGATTCTCCGTTATTGCGG
CATGGATTCTCGGTGACACTATGAAAATGAGTTACTTCTTCAACAGCACAGAGACCATCCCCTGGGCGTTCAAGC
TCTGTGGTATCTTCCAGTGTGTGTGCGACTTCTACCTGGGCTTCCAGTTCTACTTCTTCACTCGCAACACCCCAT
CTAAAACACCATCCCACTCGCTCTCCAACTCGCTCTCTAACTCGTTTGCTATCCCACACTCACACTCCAACTCAC
TCTCGCACAATTTCCCTGTCTCCGATTCTCACTCCCGCTCCAACTCCCAGGCTGCAAGCGAGTCTATGGAGAATG
ACCGCTGGGGTCATCACGAGAAGGACATCCGCATGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail