Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6436.t1
Gene name
Locationscaffold_17:197213..202639
Strand-
Gene length (bp)5426
Transcript length (bp)5130
Coding sequence length (bp)5130
Protein length (aa) 1710

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08429 PLU-1 PLU-1-like protein 4.4E-104 917 1260
PF02373 JmjC JmjC domain, hydroxylase 1.7E-42 623 739
PF01388 ARID ARID/BRIGHT DNA binding domain 5.7E-21 141 225
PF02375 JmjN jmjN domain 5.0E-17 72 105
PF00628 PHD PHD-finger 3.9E-09 451 496
PF00628 PHD PHD-finger 6.0E-07 1318 1363
PF02928 zf-C5HC2 C5HC2 zinc finger 2.9E-12 845 904

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
AT-rich interaction region

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6436.t1
MGAPASAGATSTAAASQPTRSSSTHPSHSHNVPLSARRSTPLDLSTVERRGQPNNPREPSKRIRPHGIPEAPTFR
PTEEEFKDPVAYIQKIAPEGKKYGICRVVPPEGWQPTFAIDTERFHFKTRRQELNSVEGGNRANMNYVDGLAMFH
KQHGTNYSRLPSVDKRPLDLYKLKKAVESRGGFESVCKTKKWAEIGRDLGYSGKIMSSLSTSLKNSYQRYLQPYE
EYLARAKPGVQQQLELEHGGPYTPSPLQSPMTHKPMLDENGTPSKIRDDTPSLPRMAASHTPMAFTPVAHSPMAH
TPMEKSPEKPTPPIEPTPPPASRPAPTSFTPVNSGLGGFTAVNHSPFTPVNNGPPIKREGENGTLTPKVVSEHGF
VSTPVNGQDEESLKRGISREASSQCENGDDDDGSGRRSKRLKKDSLPTVAGSHMSLLRPAPVKSRKDGSQPAGEK
CETCGKSDDQGIILVCDGCELGYHKACLDPSTTTPSEHDWHCPKCLVGTGEFGFEDGGVYSLKQFQEKANEFKKK
YFASKMPFDPVLNTHRRETEDDVEAEFWKLVVDLHETVEVEYGADIHSTTHGSGFPTIERNPLDPFSSDPWNLNV
LPFYGDSLFRYIKSDISGMTVPWVYVGMCFSTFCWHNEDHYAYSANYQHFGATKTWYGIPGADAEAFEAAMRDAV
PELFEGQPDLLFQLVTLMPPDKLRKAGVNVYALDQRAGQFVLTFPQAYHAGFNHGFNFNEAVNFAPADWEPYGAA
GVDRLQNFRRHPCFSHDELLLTAAARDTTIATAKWLAPALARTCARELRDRAAFLYRQKEISARTPGFGPDSMAD
DVQPRFVVENEDLPEDDYQCQHCKAYAYLTQFRCHKSGKTVCLSHVDTYDCCGETLAQKLCGSGHTVRYRMGDEE
LQSLVQKVQERARIPEAWSEKLDKTLEDEPKPQLKALHNLLNEGEKIPYHLPGLQDLAAFVQRCDKWVEEANNYI
TRKQQNRKKNEKAWRRGSTKASQLDDRDREVRRIEHIYALQAEADKLSFDCPQMAVLEEKTREIEKFQQDINNAL
MHPHTRPLQEIEELIERGKNFNVEVPELEHLEQVSRQIKWIEQAVRKRDHYMTLTDCRELVAGAEQVGLSDTNEH
LIHFKELARHGDAWEMKAKELMSVEAVHYQQLEALSAQASRFPVSPDTLAAVDAILTKQREAQKRIQTLYEKSKD
PEMKNRPKYKDIRDLMESLEHMTSRPIGAIDLEREQKRHEDWMRKGKKLFGKANAPLHILRSHMEYVAKRNSYCF
DLEDSYRPPVEPSSRDNSPEGLLENPSNPNNMWGPKSRKRDVFCICRHSEAGMMIECEVCHEWYHGKCLKIARGK
VKEFDKYTCPICDWRQKIPRDAARPKLEDLQDWHAEIATLPFQPEEEEVLESIINQATAFRDFLHGFTNAACTTT
EEVPTLIFYLRKIEGAEVLLTFETNFFRQEIHKWAPVAPEPPPILEQSLSTRKPRPTKQQKIMAQLGVNRPEDLP
EHLRPKHIGVTKRKSVDAQSQAAPGQSAPMQPPPPTSSSGQPPGTGPTLAQMADPNAAPYPFSANYSLPASDSTP
AFAPTSSSAFLPHAAASQSPSFLPRSPPPQPDLEPSLFSPPRFGHDPQFASSSPRQNLDDVFADLTNQEIDPEAE
TQPMENTHANEALEALVVSNDSSRAASVQEDSIQNGENGGPQGGPKLDGTNGGLEDEEL*
Coding >Pro_DTO377G3_2|g6436.t1
ATGGGAGCTCCGGCCTCTGCCGGGGCGACCTCGACGGCCGCAGCAAGCCAGCCGACTCGGTCCTCGAGTACCCAT
CCGTCGCACTCCCACAACGTGCCCCTGAGCGCTCGCAGGTCCACACCTCTCGATTTGTCCACCGTGGAACGGCGC
GGACAGCCCAACAACCCCAGAGAACCATCCAAGCGCATTCGTCCTCATGGTATCCCAGAAGCCCCGACCTTCCGT
CCGACAGAGGAGGAATTCAAAGACCCGGTGGCCTATATTCAGAAGATCGCTCCGGAGGGGAAGAAGTATGGAATT
TGCCGAGTGGTTCCACCAGAGGGCTGGCAACCGACTTTCGCAATCGATACAGAGCGATTCCACTTCAAGACACGT
CGACAAGAGCTGAATTCGGTCGAAGGAGGAAACCGCGCGAACATGAATTATGTCGATGGACTTGCCATGTTTCAC
AAACAGCATGGGACTAACTATAGCCGGCTACCCAGCGTCGACAAGCGACCATTAGATCTCTACAAACTTAAAAAG
GCAGTAGAGAGTCGTGGTGGGTTTGAATCAGTGTGCAAGACCAAAAAATGGGCCGAAATTGGTCGTGATCTTGGA
TACAGCGGCAAGATAATGTCTTCTTTGTCCACTTCGCTCAAGAACTCATACCAGCGGTATTTGCAGCCGTACGAG
GAATACCTGGCGCGGGCCAAGCCCGGTGTGCAACAACAGCTCGAGCTTGAACATGGTGGTCCATACACCCCTTCG
CCTCTACAATCCCCCATGACTCACAAGCCAATGTTGGATGAAAATGGCACGCCTTCTAAAATTCGCGATGACACT
CCTAGCTTGCCTAGAATGGCTGCTTCGCATACCCCAATGGCATTTACTCCAGTGGCACATTCTCCAATGGCACAC
ACTCCAATGGAAAAGTCCCCAGAGAAGCCAACACCCCCGATCGAACCTACTCCTCCCCCTGCTTCACGCCCAGCA
CCCACGAGCTTCACTCCCGTCAACTCCGGCCTCGGTGGCTTTACCGCCGTCAATCACTCTCCTTTCACGCCCGTG
AACAACGGCCCGCCAATCAAGCGGGAGGGAGAGAACGGCACATTGACACCCAAAGTCGTTTCCGAGCATGGTTTC
GTCTCAACGCCTGTAAATGGTCAAGATGAGGAGTCTCTGAAGCGTGGTATCAGCCGCGAGGCCAGTTCTCAGTGT
GAAAATGGCGACGATGATGATGGAAGCGGTCGACGCAGCAAGCGCCTCAAGAAAGATTCCCTTCCAACCGTTGCT
GGTTCTCATATGTCGCTCCTTCGCCCAGCACCGGTTAAATCGCGCAAGGATGGCTCCCAGCCAGCTGGAGAGAAA
TGCGAGACATGTGGCAAATCCGATGATCAAGGGATTATTCTAGTATGCGACGGCTGCGAGCTTGGATACCACAAA
GCGTGTCTCGATCCCTCTACTACCACACCATCGGAACATGACTGGCACTGTCCCAAGTGTCTAGTCGGCACAGGA
GAATTCGGATTTGAAGACGGCGGTGTTTACTCACTCAAACAGTTCCAGGAGAAGGCAAACGAGTTCAAGAAGAAG
TACTTCGCATCGAAAATGCCTTTCGATCCAGTTCTCAACACTCATCGCCGCGAAACCGAGGACGACGTGGAGGCC
GAATTCTGGAAGCTTGTCGTTGATCTACATGAGACCGTCGAAGTCGAGTACGGCGCCGACATCCATTCGACCACG
CATGGTAGTGGATTCCCAACTATCGAGCGGAACCCCCTTGATCCATTTTCGTCAGATCCTTGGAACCTAAATGTC
CTTCCATTCTATGGAGACTCGCTCTTCCGTTACATCAAGTCTGATATCTCTGGCATGACCGTTCCGTGGGTTTAT
GTGGGGATGTGTTTCTCTACTTTCTGCTGGCATAATGAGGATCACTACGCGTATTCGGCCAACTACCAACACTTC
GGTGCTACCAAGACCTGGTACGGAATCCCAGGCGCCGATGCAGAGGCCTTTGAGGCGGCCATGCGGGATGCAGTT
CCGGAGCTTTTCGAAGGCCAGCCTGATCTTCTTTTCCAGCTCGTCACCCTCATGCCGCCAGACAAGCTTCGCAAG
GCCGGAGTCAACGTTTATGCGTTGGATCAGCGAGCTGGTCAATTTGTGCTCACGTTCCCTCAAGCATACCATGCC
GGCTTTAATCACGGCTTTAATTTCAATGAAGCAGTCAACTTCGCGCCTGCGGACTGGGAACCATACGGTGCAGCA
GGTGTTGATCGTCTTCAGAACTTCCGCAGGCACCCGTGTTTCTCCCACGATGAATTACTTCTCACCGCTGCTGCA
CGTGATACCACTATTGCTACTGCTAAGTGGCTTGCGCCTGCACTAGCAAGAACGTGCGCCCGTGAACTGAGGGAT
CGGGCTGCTTTCTTATACCGGCAAAAAGAAATTTCTGCTCGCACCCCAGGCTTTGGTCCTGACTCCATGGCAGAT
GATGTGCAGCCGAGATTCGTAGTTGAGAATGAAGACCTTCCCGAGGATGATTACCAGTGCCAACATTGCAAGGCC
TACGCTTACCTCACTCAGTTCCGTTGTCACAAATCAGGCAAGACTGTCTGTTTATCGCACGTTGACACCTATGAC
TGCTGTGGCGAAACTCTTGCTCAGAAGCTGTGTGGCTCAGGACACACAGTCCGATATCGCATGGGTGATGAAGAA
TTGCAGTCTCTCGTGCAGAAAGTCCAAGAACGGGCCAGAATTCCCGAAGCATGGTCCGAAAAGCTCGACAAAACC
CTGGAGGATGAACCGAAGCCCCAGCTTAAGGCCCTTCATAACTTGCTAAATGAAGGTGAGAAAATCCCATACCAC
TTGCCAGGCCTTCAAGATCTTGCGGCCTTCGTCCAGCGTTGCGATAAATGGGTTGAAGAAGCCAACAACTACATT
ACCCGGAAGCAGCAGAACCGGAAAAAAAACGAGAAAGCTTGGCGCAGGGGCAGTACCAAGGCGTCGCAGCTGGAC
GATCGCGATCGCGAAGTCCGCAGAATTGAACATATCTACGCCCTTCAGGCAGAGGCTGATAAACTTTCGTTCGAC
TGTCCACAGATGGCGGTGTTGGAAGAGAAAACCCGCGAAATCGAGAAATTCCAACAGGATATTAATAATGCCCTC
ATGCACCCGCACACCCGGCCCCTCCAGGAGATTGAAGAACTCATCGAACGCGGCAAAAACTTCAACGTGGAAGTC
CCGGAACTGGAACACCTAGAGCAAGTCTCCCGCCAAATCAAATGGATTGAACAAGCCGTGCGCAAACGAGACCAC
TACATGACCCTTACCGATTGCCGGGAACTTGTCGCTGGTGCTGAACAGGTCGGCCTCTCTGATACCAACGAACAC
TTAATTCATTTCAAGGAACTTGCTCGTCACGGGGATGCGTGGGAAATGAAGGCCAAGGAATTAATGTCCGTTGAG
GCCGTTCACTATCAGCAATTAGAAGCTCTTTCTGCGCAGGCGTCTCGTTTTCCGGTTTCACCTGATACCCTCGCG
GCCGTCGATGCTATATTGACCAAGCAGCGTGAGGCGCAAAAACGGATACAGACTCTGTATGAAAAGAGCAAGGAC
CCGGAGATGAAGAATCGGCCCAAGTACAAGGATATCCGAGACCTCATGGAATCTCTTGAGCACATGACGAGTCGA
CCCATCGGGGCGATCGACTTGGAACGTGAACAAAAGCGCCATGAAGACTGGATGAGAAAAGGGAAAAAGTTGTTC
GGTAAGGCGAACGCGCCTCTCCATATTCTAAGATCCCATATGGAATACGTCGCGAAGCGAAACTCGTACTGTTTC
GACCTAGAGGACAGTTACCGACCTCCTGTGGAGCCTTCGTCTCGAGACAATTCTCCCGAAGGTTTGCTTGAGAAT
CCGAGCAATCCCAACAACATGTGGGGCCCAAAGTCACGAAAGCGAGATGTGTTCTGTATTTGCAGGCACTCCGAG
GCAGGAATGATGATTGAATGTGAAGTCTGCCACGAATGGTACCATGGGAAATGTTTGAAGATTGCTAGGGGTAAA
GTGAAGGAATTCGACAAGTACACTTGCCCAATCTGCGACTGGCGTCAAAAGATCCCGCGTGACGCTGCTCGTCCC
AAGCTTGAAGATCTGCAAGATTGGCACGCGGAGATCGCAACTTTGCCTTTCCAGCCCGAGGAAGAAGAAGTTCTT
GAGAGTATCATTAATCAAGCGACAGCCTTTCGTGATTTCCTGCATGGCTTCACGAATGCTGCCTGCACAACGACT
GAGGAAGTGCCAACTCTAATATTCTACCTTCGCAAAATCGAGGGCGCTGAGGTTCTTCTCACCTTTGAGACGAAT
TTCTTCCGGCAGGAGATACACAAGTGGGCACCCGTCGCACCAGAACCCCCTCCAATTCTGGAACAATCTCTCTCA
ACACGAAAACCGCGCCCGACCAAGCAACAGAAAATCATGGCTCAGCTTGGAGTCAATCGTCCAGAGGATCTCCCG
GAGCATCTTCGCCCCAAGCACATTGGCGTTACCAAAAGGAAATCTGTTGATGCTCAATCACAGGCAGCTCCTGGT
CAATCCGCACCCATGCAACCACCACCACCGACTTCTAGTAGCGGACAACCTCCTGGCACAGGTCCAACGTTGGCT
CAGATGGCAGATCCGAATGCTGCACCATACCCATTCTCCGCAAACTATTCATTACCCGCGAGCGATTCCACGCCT
GCTTTTGCACCTACCTCCTCCTCGGCTTTCCTCCCGCATGCAGCCGCTTCTCAATCCCCCTCATTCCTACCACGC
TCTCCTCCTCCTCAGCCTGACCTGGAACCCTCCCTATTCAGCCCTCCACGCTTCGGTCATGATCCCCAGTTCGCG
AGCAGCAGCCCTCGTCAGAACCTAGATGATGTATTTGCAGACCTGACCAACCAAGAGATTGACCCTGAAGCTGAG
ACCCAGCCCATGGAGAATACCCATGCTAATGAGGCCCTGGAGGCCCTCGTGGTCAGTAATGACAGTAGTCGTGCT
GCCTCTGTTCAAGAGGATTCGATTCAAAATGGCGAAAACGGTGGTCCGCAGGGTGGGCCCAAACTCGACGGCACT
AATGGTGGCCTTGAGGACGAAGAACTTTGA
Transcript >Pro_DTO377G3_2|g6436.t1
ATGGGAGCTCCGGCCTCTGCCGGGGCGACCTCGACGGCCGCAGCAAGCCAGCCGACTCGGTCCTCGAGTACCCAT
CCGTCGCACTCCCACAACGTGCCCCTGAGCGCTCGCAGGTCCACACCTCTCGATTTGTCCACCGTGGAACGGCGC
GGACAGCCCAACAACCCCAGAGAACCATCCAAGCGCATTCGTCCTCATGGTATCCCAGAAGCCCCGACCTTCCGT
CCGACAGAGGAGGAATTCAAAGACCCGGTGGCCTATATTCAGAAGATCGCTCCGGAGGGGAAGAAGTATGGAATT
TGCCGAGTGGTTCCACCAGAGGGCTGGCAACCGACTTTCGCAATCGATACAGAGCGATTCCACTTCAAGACACGT
CGACAAGAGCTGAATTCGGTCGAAGGAGGAAACCGCGCGAACATGAATTATGTCGATGGACTTGCCATGTTTCAC
AAACAGCATGGGACTAACTATAGCCGGCTACCCAGCGTCGACAAGCGACCATTAGATCTCTACAAACTTAAAAAG
GCAGTAGAGAGTCGTGGTGGGTTTGAATCAGTGTGCAAGACCAAAAAATGGGCCGAAATTGGTCGTGATCTTGGA
TACAGCGGCAAGATAATGTCTTCTTTGTCCACTTCGCTCAAGAACTCATACCAGCGGTATTTGCAGCCGTACGAG
GAATACCTGGCGCGGGCCAAGCCCGGTGTGCAACAACAGCTCGAGCTTGAACATGGTGGTCCATACACCCCTTCG
CCTCTACAATCCCCCATGACTCACAAGCCAATGTTGGATGAAAATGGCACGCCTTCTAAAATTCGCGATGACACT
CCTAGCTTGCCTAGAATGGCTGCTTCGCATACCCCAATGGCATTTACTCCAGTGGCACATTCTCCAATGGCACAC
ACTCCAATGGAAAAGTCCCCAGAGAAGCCAACACCCCCGATCGAACCTACTCCTCCCCCTGCTTCACGCCCAGCA
CCCACGAGCTTCACTCCCGTCAACTCCGGCCTCGGTGGCTTTACCGCCGTCAATCACTCTCCTTTCACGCCCGTG
AACAACGGCCCGCCAATCAAGCGGGAGGGAGAGAACGGCACATTGACACCCAAAGTCGTTTCCGAGCATGGTTTC
GTCTCAACGCCTGTAAATGGTCAAGATGAGGAGTCTCTGAAGCGTGGTATCAGCCGCGAGGCCAGTTCTCAGTGT
GAAAATGGCGACGATGATGATGGAAGCGGTCGACGCAGCAAGCGCCTCAAGAAAGATTCCCTTCCAACCGTTGCT
GGTTCTCATATGTCGCTCCTTCGCCCAGCACCGGTTAAATCGCGCAAGGATGGCTCCCAGCCAGCTGGAGAGAAA
TGCGAGACATGTGGCAAATCCGATGATCAAGGGATTATTCTAGTATGCGACGGCTGCGAGCTTGGATACCACAAA
GCGTGTCTCGATCCCTCTACTACCACACCATCGGAACATGACTGGCACTGTCCCAAGTGTCTAGTCGGCACAGGA
GAATTCGGATTTGAAGACGGCGGTGTTTACTCACTCAAACAGTTCCAGGAGAAGGCAAACGAGTTCAAGAAGAAG
TACTTCGCATCGAAAATGCCTTTCGATCCAGTTCTCAACACTCATCGCCGCGAAACCGAGGACGACGTGGAGGCC
GAATTCTGGAAGCTTGTCGTTGATCTACATGAGACCGTCGAAGTCGAGTACGGCGCCGACATCCATTCGACCACG
CATGGTAGTGGATTCCCAACTATCGAGCGGAACCCCCTTGATCCATTTTCGTCAGATCCTTGGAACCTAAATGTC
CTTCCATTCTATGGAGACTCGCTCTTCCGTTACATCAAGTCTGATATCTCTGGCATGACCGTTCCGTGGGTTTAT
GTGGGGATGTGTTTCTCTACTTTCTGCTGGCATAATGAGGATCACTACGCGTATTCGGCCAACTACCAACACTTC
GGTGCTACCAAGACCTGGTACGGAATCCCAGGCGCCGATGCAGAGGCCTTTGAGGCGGCCATGCGGGATGCAGTT
CCGGAGCTTTTCGAAGGCCAGCCTGATCTTCTTTTCCAGCTCGTCACCCTCATGCCGCCAGACAAGCTTCGCAAG
GCCGGAGTCAACGTTTATGCGTTGGATCAGCGAGCTGGTCAATTTGTGCTCACGTTCCCTCAAGCATACCATGCC
GGCTTTAATCACGGCTTTAATTTCAATGAAGCAGTCAACTTCGCGCCTGCGGACTGGGAACCATACGGTGCAGCA
GGTGTTGATCGTCTTCAGAACTTCCGCAGGCACCCGTGTTTCTCCCACGATGAATTACTTCTCACCGCTGCTGCA
CGTGATACCACTATTGCTACTGCTAAGTGGCTTGCGCCTGCACTAGCAAGAACGTGCGCCCGTGAACTGAGGGAT
CGGGCTGCTTTCTTATACCGGCAAAAAGAAATTTCTGCTCGCACCCCAGGCTTTGGTCCTGACTCCATGGCAGAT
GATGTGCAGCCGAGATTCGTAGTTGAGAATGAAGACCTTCCCGAGGATGATTACCAGTGCCAACATTGCAAGGCC
TACGCTTACCTCACTCAGTTCCGTTGTCACAAATCAGGCAAGACTGTCTGTTTATCGCACGTTGACACCTATGAC
TGCTGTGGCGAAACTCTTGCTCAGAAGCTGTGTGGCTCAGGACACACAGTCCGATATCGCATGGGTGATGAAGAA
TTGCAGTCTCTCGTGCAGAAAGTCCAAGAACGGGCCAGAATTCCCGAAGCATGGTCCGAAAAGCTCGACAAAACC
CTGGAGGATGAACCGAAGCCCCAGCTTAAGGCCCTTCATAACTTGCTAAATGAAGGTGAGAAAATCCCATACCAC
TTGCCAGGCCTTCAAGATCTTGCGGCCTTCGTCCAGCGTTGCGATAAATGGGTTGAAGAAGCCAACAACTACATT
ACCCGGAAGCAGCAGAACCGGAAAAAAAACGAGAAAGCTTGGCGCAGGGGCAGTACCAAGGCGTCGCAGCTGGAC
GATCGCGATCGCGAAGTCCGCAGAATTGAACATATCTACGCCCTTCAGGCAGAGGCTGATAAACTTTCGTTCGAC
TGTCCACAGATGGCGGTGTTGGAAGAGAAAACCCGCGAAATCGAGAAATTCCAACAGGATATTAATAATGCCCTC
ATGCACCCGCACACCCGGCCCCTCCAGGAGATTGAAGAACTCATCGAACGCGGCAAAAACTTCAACGTGGAAGTC
CCGGAACTGGAACACCTAGAGCAAGTCTCCCGCCAAATCAAATGGATTGAACAAGCCGTGCGCAAACGAGACCAC
TACATGACCCTTACCGATTGCCGGGAACTTGTCGCTGGTGCTGAACAGGTCGGCCTCTCTGATACCAACGAACAC
TTAATTCATTTCAAGGAACTTGCTCGTCACGGGGATGCGTGGGAAATGAAGGCCAAGGAATTAATGTCCGTTGAG
GCCGTTCACTATCAGCAATTAGAAGCTCTTTCTGCGCAGGCGTCTCGTTTTCCGGTTTCACCTGATACCCTCGCG
GCCGTCGATGCTATATTGACCAAGCAGCGTGAGGCGCAAAAACGGATACAGACTCTGTATGAAAAGAGCAAGGAC
CCGGAGATGAAGAATCGGCCCAAGTACAAGGATATCCGAGACCTCATGGAATCTCTTGAGCACATGACGAGTCGA
CCCATCGGGGCGATCGACTTGGAACGTGAACAAAAGCGCCATGAAGACTGGATGAGAAAAGGGAAAAAGTTGTTC
GGTAAGGCGAACGCGCCTCTCCATATTCTAAGATCCCATATGGAATACGTCGCGAAGCGAAACTCGTACTGTTTC
GACCTAGAGGACAGTTACCGACCTCCTGTGGAGCCTTCGTCTCGAGACAATTCTCCCGAAGGTTTGCTTGAGAAT
CCGAGCAATCCCAACAACATGTGGGGCCCAAAGTCACGAAAGCGAGATGTGTTCTGTATTTGCAGGCACTCCGAG
GCAGGAATGATGATTGAATGTGAAGTCTGCCACGAATGGTACCATGGGAAATGTTTGAAGATTGCTAGGGGTAAA
GTGAAGGAATTCGACAAGTACACTTGCCCAATCTGCGACTGGCGTCAAAAGATCCCGCGTGACGCTGCTCGTCCC
AAGCTTGAAGATCTGCAAGATTGGCACGCGGAGATCGCAACTTTGCCTTTCCAGCCCGAGGAAGAAGAAGTTCTT
GAGAGTATCATTAATCAAGCGACAGCCTTTCGTGATTTCCTGCATGGCTTCACGAATGCTGCCTGCACAACGACT
GAGGAAGTGCCAACTCTAATATTCTACCTTCGCAAAATCGAGGGCGCTGAGGTTCTTCTCACCTTTGAGACGAAT
TTCTTCCGGCAGGAGATACACAAGTGGGCACCCGTCGCACCAGAACCCCCTCCAATTCTGGAACAATCTCTCTCA
ACACGAAAACCGCGCCCGACCAAGCAACAGAAAATCATGGCTCAGCTTGGAGTCAATCGTCCAGAGGATCTCCCG
GAGCATCTTCGCCCCAAGCACATTGGCGTTACCAAAAGGAAATCTGTTGATGCTCAATCACAGGCAGCTCCTGGT
CAATCCGCACCCATGCAACCACCACCACCGACTTCTAGTAGCGGACAACCTCCTGGCACAGGTCCAACGTTGGCT
CAGATGGCAGATCCGAATGCTGCACCATACCCATTCTCCGCAAACTATTCATTACCCGCGAGCGATTCCACGCCT
GCTTTTGCACCTACCTCCTCCTCGGCTTTCCTCCCGCATGCAGCCGCTTCTCAATCCCCCTCATTCCTACCACGC
TCTCCTCCTCCTCAGCCTGACCTGGAACCCTCCCTATTCAGCCCTCCACGCTTCGGTCATGATCCCCAGTTCGCG
AGCAGCAGCCCTCGTCAGAACCTAGATGATGTATTTGCAGACCTGACCAACCAAGAGATTGACCCTGAAGCTGAG
ACCCAGCCCATGGAGAATACCCATGCTAATGAGGCCCTGGAGGCCCTCGTGGTCAGTAATGACAGTAGTCGTGCT
GCCTCTGTTCAAGAGGATTCGATTCAAAATGGCGAAAACGGTGGTCCGCAGGGTGGGCCCAAACTCGACGGCACT
AATGGTGGCCTTGAGGACGAAGAACTTTGA
Gene >Pro_DTO377G3_2|g6436.t1
ATGGGAGCTCCGGCCTCTGCCGGGGCGACCTCGACGGCCGCAGCAAGCCAGCCGACTCGGTCCTCGAGTACCCAT
CCGTCGCACTCCCACAACGTGCCCCTGAGCGCTCGCAGGTCCACACCTCTCGATTTGTCCACCGTGGAACGGCGC
GGACAGCCCAACAACCCCAGAGAACCATCCAAGCGCATTCGTCCTCATGGTATCCCAGAAGCCCCGACCTTCCGT
CCGACAGAGGAGGAATTCAAAGACCCGGTGGCCTATATTCAGAAGATCGCTCCGGAGGGGAAGAAGTATGGAATT
TGCCGAGTGGTTCCACCAGAGGGCTGGCAACCGACTTTCGCAATCGATACAGAGGTAGGATCCCTCCTTCACCGG
CCCACCGTCGCTTTCCGCGCATGATCACGTCTGACAATGGATATAGCGATTCCACTTCAAGACACGTCGACAAGA
GCTGAATTCGGTCGAAGGAGGTAAGGCCCCACGCCCAGCTTACTCCAGCTGGTAGGATCACACCGCAGTGCGGAT
CTAACCCTTATTCGAACATAGGAAACCGCGCGAACATGAATTATGTCGATGGACTTGCCATGTTTCACAAACAGC
ATGGGACTAACTATAGCCGGCTACCCAGCGTCGACAAGCGACCATTAGATCTCTACAAACTTAAAAAGGCAGTAG
AGAGTCGTGGTGGGTTTGAATCAGTGTGCAAGACCAAAAAATGGGCCGAAATTGGTCGTGATCTTGGATACAGCG
GCAAGATAATGTCTTCTTTGTCCACTTCGCTCAAGAACTCATACCAGCGGTATTTGCAGCCGTACGAGGAATACC
TGGCGCGGGCCAAGCCCGGTGTGCAACAACAGCTCGAGCTTGAACATGGTGGTCCATACACCCCTTCGCCTCTAC
AATCCCCCATGACTCACAAGCCAATGTTGGATGAAAATGGCACGCCTTCTAAAATTCGCGATGACACTCCTAGCT
TGCCTAGAATGGCTGCTTCGCATACCCCAATGGCATTTACTCCAGTGGCACATTCTCCAATGGCACACACTCCAA
TGGAAAAGTCCCCAGAGAAGCCAACACCCCCGATCGAACCTACTCCTCCCCCTGCTTCACGCCCAGCACCCACGA
GCTTCACTCCCGTCAACTCCGGCCTCGGTGGCTTTACCGCCGTCAATCACTCTCCTTTCACGCCCGTGAACAACG
GCCCGCCAATCAAGCGGGAGGGAGAGAACGGCACATTGACACCCAAAGTCGTTTCCGAGCATGGTTTCGTCTCAA
CGCCTGTAAATGGTCAAGATGAGGAGTCTCTGAAGCGTGGTATCAGCCGCGAGGCCAGTTCTCAGTGTGAAAATG
GCGACGATGATGATGGAAGCGGTCGACGCAGCAAGCGCCTCAAGAAAGGTACGCTTTTTTGCCCTTTTAATATTC
GAAGCAAATCTTGTCTAACCCTTCTAGATTCCCTTCCAACCGTTGCTGGTTCTCATATGTCGCTCCTTCGCCCAG
CACCGGTTAAATCGCGCAAGGATGGCTCCCAGCCAGCTGGAGAGGTAGGCGGGGGTTCGTGTCAGGGTTCTGATG
ATATACTGATCCATGAACAGAAATGCGAGACATGTGGCAAATCCGATGATCAAGGGATTATTCTAGTATGCGACG
GCTGCGAGCTTGGATACCACAAAGCGTGTCTCGATCCCTCTACTACCACACCATCGGAACATGACTGGCACTGTC
CCAAGTGTCTAGTCGGCACAGGAGAATTCGGATTTGAAGACGGCGGTGTTTACTCACTCAAACAGTTCCAGGAGA
AGGCAAACGAGTTCAAGAAGAAGTACTTCGCATCGAAAATGCCTTTCGATCCAGTTCTCAACACTCATCGCCGCG
AAACCGAGGACGACGTGGAGGCCGAATTCTGGAAGCTTGTCGTTGATCTACATGAGACCGTCGAAGTCGAGTACG
GCGCCGACATCCATTCGACCACGCATGGTAGTGGATTCCCAACTATCGAGCGGAACCCCCTTGATCCATTTTCGT
CAGATCCTTGGAACCTAAATGTCCTTCCATTCTATGGAGACTCGCTCTTCCGTTACATCAAGTCTGATATCTCTG
GCATGACCGTTCCGTGGGTTTATGTGGGGATGTGTTTCTCTACTTTCTGCTGGCATAATGAGGATCACTACGCGT
ATTCGGCCAACTACCAACACTTCGGTGCTACCAAGACCTGGTACGGAATCCCAGGCGCCGATGCAGAGGCCTTTG
AGGCGGCCATGCGGGATGCAGTTCCGGAGCTTTTCGAAGGCCAGCCTGATCTTCTTTTCCAGCTCGTCACCCTCA
TGCCGCCAGACAAGCTTCGCAAGGCCGGAGTCAACGTTTATGCGTTGGATCAGCGAGCTGGTCAATTTGTGCTCA
CGTTCCCTCAAGCATACCATGCCGGCTTTAATCACGGCTTTAATTTCAATGAAGCAGTCAACTTCGCGCCTGCGG
ACTGGGAACCATACGGTGCAGCAGGTGTTGATCGTCTTCAGAACTTCCGCAGGCACCCGTGTTTCTCCCACGATG
AATTACTTCTCACCGCTGCTGCACGTGATACCACTATTGCTACTGCTAAGTGGCTTGCGCCTGCACTAGCAAGAA
CGTGCGCCCGTGAACTGAGGGATCGGGCTGCTTTCTTATACCGGCAAAAAGAAATTTCTGCTCGCACCCCAGGCT
TTGGTCCTGACTCCATGGCAGATGATGTGCAGCCGAGATTCGTAGTTGAGAATGAAGACCTTCCCGAGGATGATT
ACCAGTGCCAACATTGCAAGGCCTACGCTTACCTCACTCAGTTCCGTTGTCACAAATCAGGCAAGACTGTCTGTT
TATCGCACGTTGACACCTATGACTGCTGTGGCGAAACTCTTGCTCAGAAGCTGTGTGGCTCAGGACACACAGTCC
GATATCGCATGGGTGATGAAGAATTGCAGTCTCTCGTGCAGAAAGTCCAAGAACGGGCCAGAATTCCCGAAGCAT
GGTCCGAAAAGCTCGACAAAACCCTGGAGGATGAACCGAAGCCCCAGCTTAAGGCCCTTCATAACTTGCTAAATG
AAGGTGAGAAAATCCCATACCACTTGCCAGGCCTTCAAGATCTTGCGGCCTTCGTCCAGCGTTGCGATAAATGGG
TTGAAGAAGCCAACAACTACATTACCCGGAAGCAGCAGAACCGGAAAAAAAACGAGAAAGCTTGGCGCAGGGGCA
GTACCAAGGCGTCGCAGCTGGACGATCGCGATCGCGAAGTCCGCAGAATTGAACATATCTACGCCCTTCAGGCAG
AGGCTGATAAACTTTCGTTCGACTGTCCACAGATGGCGGTGTTGGAAGAGAAAACCCGCGAAATCGAGAAATTCC
AACAGGATATTAATAATGCCCTCATGCACCCGCACACCCGGCCCCTCCAGGAGATTGAAGAACTCATCGAACGCG
GCAAAAACTTCAACGTGGAAGTCCCGGAACTGGAACACCTAGAGCAAGTCTCCCGCCAAATCAAATGGATTGAAC
AAGCCGTGCGCAAACGAGACCACTACATGACCCTTACCGATTGCCGGGAACTTGTCGCTGGTGCTGAACAGGTCG
GCCTCTCTGATACCAACGAACACTTAATTCATTTCAAGGAACTTGCTCGTCACGGGGATGCGTGGGAAATGAAGG
CCAAGGAATTAATGTCCGTTGAGGCCGTTCACTATCAGCAATTAGAAGCTCTTTCTGCGCAGGCGTCTCGTTTTC
CGGTTTCACCTGATACCCTCGCGGCCGTCGATGCTATATTGACCAAGCAGCGTGAGGCGCAAAAACGGATACAGA
CTCTGTATGAAAAGAGCAAGGACCCGGAGATGAAGAATCGGCCCAAGTACAAGGATATCCGAGACCTCATGGAAT
CTCTTGAGCACATGACGAGTCGACCCATCGGGGCGATCGACTTGGAACGTGAACAAAAGCGCCATGAAGACTGGA
TGAGAAAAGGGAAAAAGTTGTTCGGTAAGGCGAACGCGCCTCTCCATATTCTAAGATCCCATATGGAATACGTCG
CGAAGCGAAACTCGTACTGTTTCGACCTAGAGGACAGTTACCGACCTCCTGTGGAGCCTTCGTCTCGAGACAATT
CTCCCGAAGGTTTGCTTGAGAATCCGAGCAATCCCAACAACATGTGGGGCCCAAAGTCACGAAAGCGAGATGTGT
TCTGTATTTGCAGGCACTCCGAGGCAGGAATGATGATTGAATGTGAAGTCTGCCACGAATGGTAAGCCAAAAAAC
TTCCAGCTTGTGGTTTATTTACTGACCTGTGTAGGTACCATGGGAAATGTTTGAAGATTGCTAGGGGTAAAGTGA
AGGAATTCGACAAGTACACTTGCCCAATCTGCGACTGGCGTCAAAAGATCCCGCGTGACGCTGCTCGTCCCAAGC
TTGAAGATCTGCAAGATTGGCACGCGGAGATCGCAACTTTGCCTTTCCAGCCCGAGGAAGAAGAAGTTCTTGAGA
GTATCATTAATCAAGCGACAGCCTTTCGTGATTTCCTGCATGGCTTCACGAATGCTGCCTGCACAACGACTGAGG
AAGTGCCAACTCTAATATTCTACCTTCGCAAAATCGAGGGCGCTGAGGTTCTTCTCACCTTTGAGACGAATTTCT
TCCGGCAGGAGATACACAAGTGGGCACCCGTCGCACCAGAACCCCCTCCAATTCTGGAACAATCTCTCTCAACAC
GAAAACCGCGCCCGACCAAGCAACAGAAAATCATGGCTCAGCTTGGAGTCAATCGTCCAGAGGATCTCCCGGAGC
ATCTTCGCCCCAAGCACATTGGCGTTACCAAAAGGAAATCTGTTGATGCTCAATCACAGGCAGCTCCTGGTCAAT
CCGCACCCATGCAACCACCACCACCGACTTCTAGTAGCGGACAACCTCCTGGCACAGGTCCAACGTTGGCTCAGA
TGGCAGATCCGAATGCTGCACCATACCCATTCTCCGCAAACTATTCATTACCCGCGAGCGATTCCACGCCTGCTT
TTGCACCTACCTCCTCCTCGGCTTTCCTCCCGCATGCAGCCGCTTCTCAATCCCCCTCATTCCTACCACGCTCTC
CTCCTCCTCAGCCTGACCTGGAACCCTCCCTATTCAGCCCTCCACGCTTCGGTCATGATCCCCAGTTCGCGAGCA
GCAGCCCTCGTCAGAACCTAGATGATGTATTTGCAGACCTGACCAACCAAGAGATTGACCCTGAAGCTGAGACCC
AGCCCATGGAGAATACCCATGCTAATGAGGCCCTGGAGGCCCTCGTGGTCAGTAATGACAGTAGTCGTGCTGCCT
CTGTTCAAGAGGATTCGATTCAAAATGGCGAAAACGGTGGTCCGCAGGGTGGGCCCAAACTCGACGGCACTAATG
GTGGCCTTGAGGACGAAGAACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail