Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6434.t1
Gene name
Locationscaffold_17:194084..195491
Strand-
Gene length (bp)1407
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02833 DHHA2 DHHA2 domain 1.9E-31 288 464

GO

GO Term Description Terminal node
GO:0016462 pyrophosphatase activity Yes
GO:0005737 cytoplasm Yes
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 123.28 75.27 171.29
5d_25C Five days - 25 degrees Celsius 143.28 87.31 199.26
7d_25C Seven days - 25 degrees Celsius 122.50 73.85 171.14
10d_25C Ten days - 25 degrees Celsius 151.71 92.21 211.20
7d_15C Seven days - 15 degrees Celsius 194.48 113.33 275.63
7d_30C Seven days - 30 degrees Celsius 118.73 70.07 167.39

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.569007 no
3d_25C 7d_25C 0.986282 no
3d_25C 7d_15C 0.035668 yes
3d_25C 7d_30C 0.914614 no
3d_25C 10d_25C 0.399194 no
5d_25C 7d_25C 0.553728 no
5d_25C 7d_15C 0.182527 no
5d_25C 7d_30C 0.460358 no
5d_25C 10d_25C 0.857129 no
7d_25C 7d_15C 0.033480 yes
7d_25C 7d_30C 0.930319 no
7d_25C 10d_25C 0.383526 no
7d_15C 7d_30C 0.018034 yes
7d_15C 10d_25C 0.298096 no
7d_30C 10d_25C 0.301341 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6434.t1
MTLLQFLRQARQVHLHFLSGALTEPPIYVIGNPSADLDSIVSAIIYSYCANNRLPIQSPRPHIPLLNLSNFPAGT
ELYRLRPEFSAALWSSTNFPPLKSEEQFENTLQSAGNFLPEYVMTVADFAQSLEDQHVWHQILADATLVDWNAFP
RPSKTDKGSGFLTGLPGVSFRTVGCIDHHIDEHNMPSIDGLPEGQPMIIQPGPGSCASLITRELRQRKLWDTTPE
MTQVAKLALSAVLIDTLNLTAEGKVTDVDREAVEFLRSQIEGESQAAASSEGDWELETFYKSILHAKLNSLDLLT
MEEILNRDYKDWIETSQSSGETVKMGFCSAVKPIRWLVQKAGGPEKFLDAALSFAASAEKDLDVLVIMTAFTGTD
DKFCRELFVIVTGGNEAAVKGVERFIEQSSHHLGLVEWSPLDGEDIPELTGDCLSTLNVDEDSLHWRQLWVQTNA
AGSRKQVAPLLRAAVAKL*
Coding >Pro_DTO377G3_2|g6434.t1
ATGACTCTCCTCCAGTTCTTACGCCAAGCCCGCCAAGTGCACCTTCACTTCCTCTCGGGTGCTCTAACCGAGCCT
CCAATCTATGTAATCGGCAATCCCTCTGCCGACCTTGACTCTATCGTCTCGGCGATCATCTACTCTTACTGCGCG
AACAACCGGCTTCCGATCCAAAGCCCACGACCCCATATCCCACTACTAAACCTGTCCAATTTCCCCGCTGGGACA
GAGCTGTATCGACTAAGACCGGAATTCTCGGCTGCATTATGGTCATCAACCAATTTCCCCCCTCTGAAGAGTGAA
GAGCAATTCGAGAACACCCTTCAGTCTGCGGGCAATTTTCTACCCGAGTATGTTATGACCGTCGCGGACTTCGCG
CAGTCTCTCGAAGACCAGCATGTGTGGCACCAGATACTCGCCGATGCAACGCTGGTAGACTGGAACGCGTTCCCG
CGGCCATCAAAGACCGATAAGGGCTCTGGGTTCCTAACTGGGTTGCCGGGTGTCTCCTTCCGGACTGTAGGATGT
ATCGACCACCACATCGACGAGCACAACATGCCAAGCATTGACGGCTTACCAGAAGGGCAGCCGATGATTATCCAA
CCGGGACCTGGGTCATGTGCATCGCTCATCACGCGAGAGTTGCGACAACGGAAACTCTGGGACACGACCCCGGAA
ATGACACAGGTTGCGAAGCTTGCTCTTTCGGCGGTGCTGATTGATACTTTAAATCTCACCGCGGAAGGCAAAGTG
ACCGATGTAGATCGTGAGGCGGTCGAATTCCTGCGATCTCAAATCGAGGGAGAATCACAAGCTGCAGCGAGTTCA
GAAGGCGATTGGGAGCTGGAAACGTTCTACAAGAGCATTCTTCATGCAAAGCTGAATAGTCTCGATCTTCTTACG
ATGGAGGAAATATTGAACCGCGATTATAAAGACTGGATTGAGACGTCACAGTCCTCGGGGGAGACTGTGAAAATG
GGCTTCTGTTCTGCCGTCAAGCCCATACGATGGCTTGTTCAGAAGGCAGGTGGCCCGGAGAAGTTCCTTGATGCT
GCGCTCTCGTTCGCGGCTTCTGCTGAGAAAGACTTGGATGTGCTTGTTATCATGACGGCGTTCACGGGCACTGAC
GACAAGTTTTGTCGCGAGCTATTCGTCATCGTGACGGGTGGCAATGAAGCGGCTGTCAAGGGTGTGGAGAGGTTT
ATTGAGCAATCCTCTCACCATCTTGGGCTTGTAGAATGGTCTCCGCTCGATGGGGAGGATATCCCTGAGCTGACA
GGCGATTGTCTTTCTACATTGAACGTGGACGAGGATTCCCTCCACTGGAGGCAGCTGTGGGTGCAAACCAACGCG
GCTGGGAGTAGGAAGCAAGTTGCTCCATTGCTGCGCGCGGCGGTAGCTAAATTATAA
Transcript >Pro_DTO377G3_2|g6434.t1
ATGACTCTCCTCCAGTTCTTACGCCAAGCCCGCCAAGTGCACCTTCACTTCCTCTCGGGTGCTCTAACCGAGCCT
CCAATCTATGTAATCGGCAATCCCTCTGCCGACCTTGACTCTATCGTCTCGGCGATCATCTACTCTTACTGCGCG
AACAACCGGCTTCCGATCCAAAGCCCACGACCCCATATCCCACTACTAAACCTGTCCAATTTCCCCGCTGGGACA
GAGCTGTATCGACTAAGACCGGAATTCTCGGCTGCATTATGGTCATCAACCAATTTCCCCCCTCTGAAGAGTGAA
GAGCAATTCGAGAACACCCTTCAGTCTGCGGGCAATTTTCTACCCGAGTATGTTATGACCGTCGCGGACTTCGCG
CAGTCTCTCGAAGACCAGCATGTGTGGCACCAGATACTCGCCGATGCAACGCTGGTAGACTGGAACGCGTTCCCG
CGGCCATCAAAGACCGATAAGGGCTCTGGGTTCCTAACTGGGTTGCCGGGTGTCTCCTTCCGGACTGTAGGATGT
ATCGACCACCACATCGACGAGCACAACATGCCAAGCATTGACGGCTTACCAGAAGGGCAGCCGATGATTATCCAA
CCGGGACCTGGGTCATGTGCATCGCTCATCACGCGAGAGTTGCGACAACGGAAACTCTGGGACACGACCCCGGAA
ATGACACAGGTTGCGAAGCTTGCTCTTTCGGCGGTGCTGATTGATACTTTAAATCTCACCGCGGAAGGCAAAGTG
ACCGATGTAGATCGTGAGGCGGTCGAATTCCTGCGATCTCAAATCGAGGGAGAATCACAAGCTGCAGCGAGTTCA
GAAGGCGATTGGGAGCTGGAAACGTTCTACAAGAGCATTCTTCATGCAAAGCTGAATAGTCTCGATCTTCTTACG
ATGGAGGAAATATTGAACCGCGATTATAAAGACTGGATTGAGACGTCACAGTCCTCGGGGGAGACTGTGAAAATG
GGCTTCTGTTCTGCCGTCAAGCCCATACGATGGCTTGTTCAGAAGGCAGGTGGCCCGGAGAAGTTCCTTGATGCT
GCGCTCTCGTTCGCGGCTTCTGCTGAGAAAGACTTGGATGTGCTTGTTATCATGACGGCGTTCACGGGCACTGAC
GACAAGTTTTGTCGCGAGCTATTCGTCATCGTGACGGGTGGCAATGAAGCGGCTGTCAAGGGTGTGGAGAGGTTT
ATTGAGCAATCCTCTCACCATCTTGGGCTTGTAGAATGGTCTCCGCTCGATGGGGAGGATATCCCTGAGCTGACA
GGCGATTGTCTTTCTACATTGAACGTGGACGAGGATTCCCTCCACTGGAGGCAGCTGTGGGTGCAAACCAACGCG
GCTGGGAGTAGGAAGCAAGTTGCTCCATTGCTGCGCGCGGCGGTAGCTAAATTATAA
Gene >Pro_DTO377G3_2|g6434.t1
ATGACTCTCCTCCAGTTCTTACGCCAAGCCCGCCAAGTGCACCTTCACTTCCTCTCGGGTGCTCTAACCGAGCCT
CCAATCTATGTAATCGGCAATCCCTCTGCCGACCTTGACTCTATCGTCTCGGCGATCATCTACTCTTACTGCGCG
AACAACCGGCTTCCGATCCAAAGCCCACGACCCCATATCCCACTACTAAACCTGTCCAATTTCCCCGCTGGGACA
GAGCTGTATCGACTAAGACCGGAATTCTCGGCTGCATTATGGTCATCAACCAATTTCCCCCCTCTGAAGAGTGAA
GAGCAATTCGAGAACACCCTTCAGTCTGCGGGCAATTTTCTACCCGAGTATGTTATGACCGTCGCGGACTTCGCG
CAGTCTCTCGAAGACCAGCATGTGTGGCACCAGATACTCGCCGATGCAACGCTGGTAGACTGGAACGCGTTCCCG
CGGCCATCAAAGACCGATAAGGGCTCTGGGTTCCTAACTGGGTTGCCGGGTGTCTCCTTCCGGACTGTAGGATGT
ATCGACCACCACATCGACGAGCACAACATGCCAAGCATTGACGGCTTACCAGAAGGGCAGCCGATGATTATCCAA
CCGGGACCTGGGTCATGTGCATCGCTCATCACGCGAGAGTTGCGACAACGGAAACTCTGGGACACGACCCCGGAA
ATGACACAGGTTGCGAAGCTTGCTCTTTCGGCGGTGCTGATTGATACTTTAAATCTCACCGCGGAAGGCAAAGTG
ACCGATGTAGATCGTGAGGCGGTCGAATTCCTGCGATCTCAAATCGAGGGAGAATCACAAGCTGCAGCGAGTTCA
GAAGGCGATTGGGAGCTGGAAACGTTCTACAAGAGCATTCTTCATGCAAAGCTGAATAGTCTCGATCTTCTTACG
ATGGAGGAAATATTGAACCGCGATTATAAAGACTGGATTGAGACGTCACAGTCCTCGGGGGAGACTGTGAAAATG
GGCTTCTGTTCTGCCGTCAAGCCCATACGATGGCTTGTTCAGAAGGCAGGTGGCCCGGAGAAGTTCCTTGATGCT
GCGCTCTCGTTCGCGGCTTCTGCTGAGAAAGACTTGGATGTGCTTGTTATCATGACGGCGTTCACGGGCACTGAC
GACAAGTTTTGTCGCGAGCTATTCGTCATCGTGACGGGTGGCAATGAAGCGGCTGTCAAGGGTGTGGAGAGGTTT
ATTGAGCAATCCTCTCACCATCTTGGGCTTGTAGAATGGTCTCCGCTCGATGGGGAGGATATCCCTGAGCTGACA
GGCGATTGTCTTTCTACATTGAACGTGGACGAGGATTCCCTCCACTGGAGGCAGCTGTGGGTGCAAACCAACGCG
GCTGGGAGTAGGAAGCAAGTTGCTCCATTGCTGCGCGCGGCGGTAGCTAAATTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail