Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6432.t1
Gene name
Locationscaffold_17:178240..184892
Strand-
Gene length (bp)6652
Transcript length (bp)6411
Coding sequence length (bp)6411
Protein length (aa) 2137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 4.2E-84 8 244
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.5E-79 374 623
PF00698 Acyl_transf_1 Acyl transferase domain 5.3E-43 910 1212
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 4.7E-33 631 750
PF00550 PP-binding Phosphopantetheine attachment site 9.4E-10 1645 1706
PF00550 PP-binding Phosphopantetheine attachment site 3.2E-12 1764 1827
PF00975 Thioesterase Thioesterase domain 1.2E-21 1881 1986
PF14765 PS-DH Polyketide synthase dehydratase 2.1E-12 1302 1593

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6432.t1
MEGPSHLYLFGDQTADFDSGLRRLLHAKNDSLVAAFFQKCYYALRKEITSLPPSERQGFPRFTSIVDLLARFKES
GPNPALESALTTIYQLGCFIHYYGDLGHAYPSGDDSCIIGLCTGQLASAAVSSSKTIGELIAAGIETVLVSLRLG
MCVLKVQELIEPSKSATSSWSVLISGMHEPEAQDLIQQYTKKNALPRVSQPYISAVSPNGLTISGPPTFLGRFIE
SSLSKEHKPTMVPIHGPYHASHLYDNRDINRILESWPTENFMMYVPQIPVLSSETGKELQAESLEQLLRFSLQEI
LQRQLCWGKVIQSCQSILESTKTCTLFPISSTATQSLFNSLKKAGVSNLEVDSTLGDVRKDAGGDNRTGRAEQSK
IAIIGLSGRFPDSPDTEAFWDLLKKGLDVHREVPPERWDVKAHVDMEGKKRNTSQVQYGCWYDDAGMFDPRFFNM
SPREALQADPAQRLALLTAYEALEMAGFIPDSTPSTQKNRVGVFYGMTSDDYRETNSGQDIDTYFIPGGNRAFTP
GRINYYFKFSGPSVSVDTACSSSLAAIHVACNSLWRNECDSAVTGGVNILANPDNHAGLDRGHFLSRTGNCTTFD
DGADGYCRADGVGSIVIKRLEDAQADNDPIYGIIGGAYTNHSAEAVSITRPHVGAQSFIFDKLLNESNSDPKEIS
YIEMHGTGTQAGDAVEMQSVLDVFAPDYRRGPTQSLHLGSAKSNVGHGESASGVTALIKVLMMMRKNMIPPHCGI
KTKINHNFPTDFPQRNVHIASEAVPWNRPNGGKRKTFINNFSAAGGNTALMVEDGPLNDENVEDIRSAHPVLVSA
RSQSALKNNISALVQYIDTNKNSFNSNDASLLANLSYTTTARRIHHPFRVAVTGSTLDEVRSALAPIVNRDSISP
APANAPGIGFIFTGQGAQYTGMGRQLFDSCSQFRAHIEHLNCICESQGFPSILSLVDGSVPIEEHSPIVTQLGTT
CVQMALTKYWMSLGIVPTFVIGHSLGEFAALNASGVLTTSDTIYLAGRRAQLLTEQIEVGTHAMLAVKSSVAQVK
QFLDEATEVACINAPSETVISGASEKIDELAQTLTNEGFKATKLNVPFAFHSAQVEPILESLAEIGKGVNFNAPS
IPFVSALLGDVINETNGELLGTNYLTRHCRETVNFLGALEATRHSNLMNDKTIWVEIGSHPVCSGMVKATFGPQA
TTVASLRRQEDTWKVLSTSVSALYMAGIDIRWKEYHQDFTGHKVLPLPSYKWDLKNYWIPYTNNFCLLKGAPPVS
VADAAPVSVFLSSAAQKVLETSGDNSSASIVIENDIADPDLNRVIAGHKVNGACLTPSSLYADIAQTLGEYLVQN
YKPEWKDRGFDVCNMVVPKPLIAKGGKQLFRVSATANWAEENAKVQVWSVTPEGKKILDHATCYIKFFDPSTYDV
EWKRSSYLIKRSIEHLQESTVSGQAHRMKRGMVYKLFASLVDYDENYKSIREVILDSDQHEATALVKFEAPPGNF
HRNPFWIDSIGHLSGFIMNASDNTDSKNQVFVNHGWDSMRCLKKFDPSVTYRTYVRMQPWKESIWAGDVYMFDGD
DIVAVFGGVKFQALARKILDMALPPAGAASKPAAKRVPAPVNIEKAKTGSAKKAAPSPRSGMPSLTMRALAILAE
EVGLSASELTDDLNFADYGVDSLLSLTVTGRYREDMGLDLDSTIFVDNPTVKDFKNLLAQMSPSESSDGSSSEGD
MSSAASSTDLSTPNSSGLPSPANEKPMAHGSQEQNDSMRQIASILAEEIGVEPEELDGDANLAEMGLDSLMSLTV
LGKIREDLDLDLSGEFFIENQTLDDIETTLGLKPKPAPAEPIRFPEQIPVRAPVVAPSTTPQHPPATSILLQGNP
KTATQSLFLFPDGSGSATSYASIPGISPDVCVYGLNCPYMRTPENLKARLDELTAPYIAEIRRRQPTGPYNFGGW
SAGGICAYDAARQLIFEEGERVERLLLLDSPFPVGLEKLPRRLYSFFDTVGLFGEGKAPPPKWLLPHFLAFIDSL
DAYKAVPFPHTDPKLADKLPKTFMVWAKDGVCSKPGDARPAPAADGSPDPREMLWLLNNRTDLGPNGWDTLVGPN
HVGGITVMEDANHFTMTRGEKAKELATFIANSMASA*
Coding >Pro_DTO377G3_2|g6432.t1
ATGGAGGGCCCCAGTCATTTGTATCTCTTTGGAGATCAGACTGCGGATTTTGACTCCGGGCTTCGTCGGCTGTTG
CATGCTAAGAATGACTCGCTTGTAGCAGCATTCTTCCAAAAGTGCTACTATGCGTTACGCAAGGAAATTACATCG
CTTCCGCCATCCGAACGTCAGGGCTTCCCTCGCTTTACTAGTATCGTTGACCTTCTCGCGAGGTTCAAAGAGTCA
GGGCCGAACCCAGCTCTAGAGAGTGCATTGACAACAATTTACCAACTAGGATGCTTCATCCACTACTATGGTGAT
TTGGGCCATGCCTATCCGTCGGGTGATGACAGCTGCATCATTGGACTTTGCACCGGTCAACTCGCATCTGCGGCC
GTAAGCTCTTCGAAAACTATCGGGGAGCTTATTGCAGCTGGAATTGAGACCGTCCTTGTTTCCTTGAGGCTCGGG
ATGTGCGTTTTGAAAGTACAAGAGCTCATAGAACCAAGCAAATCGGCAACATCAAGCTGGTCTGTACTAATTTCT
GGTATGCACGAGCCCGAGGCCCAGGATTTGATTCAACAGTACACGAAGAAGAATGCCTTGCCCCGCGTTTCTCAA
CCTTATATCAGCGCAGTAAGCCCCAATGGACTCACAATCAGTGGTCCCCCGACTTTTCTGGGCCGTTTCATTGAG
TCCAGTCTCTCAAAGGAGCACAAGCCCACAATGGTTCCAATCCACGGCCCTTATCATGCCTCTCATCTATATGAT
AACAGGGACATTAACCGAATTTTGGAATCGTGGCCTACAGAGAATTTCATGATGTACGTGCCTCAGATCCCTGTG
CTGTCAAGTGAGACAGGCAAGGAGCTCCAGGCTGAGAGCCTTGAGCAGCTCTTGAGATTTTCTCTTCAGGAGATT
CTACAAAGACAGCTTTGCTGGGGCAAGGTCATCCAATCTTGCCAGTCAATCTTGGAGTCTACAAAAACATGCACT
CTGTTCCCAATTTCCAGCACTGCAACCCAGAGCCTATTTAACTCATTGAAAAAGGCTGGAGTCTCCAATCTCGAG
GTTGACAGCACACTTGGTGATGTCCGGAAGGATGCTGGTGGAGATAATCGTACCGGCCGTGCTGAGCAGTCCAAA
ATTGCAATTATTGGTCTTTCAGGAAGATTTCCAGATTCGCCTGATACCGAAGCTTTCTGGGATCTTTTGAAAAAA
GGACTGGACGTCCACCGCGAGGTTCCCCCAGAGCGATGGGATGTCAAGGCTCACGTTGACATGGAAGGAAAGAAA
AGAAATACCAGCCAAGTCCAATATGGATGCTGGTATGACGACGCGGGCATGTTTGACCCTCGATTTTTCAATATG
TCTCCCCGTGAAGCACTTCAAGCAGATCCTGCTCAACGTCTGGCACTCTTGACTGCTTATGAGGCTTTGGAAATG
GCAGGCTTCATCCCTGACAGCACGCCCTCTACGCAGAAGAACCGAGTGGGTGTCTTCTATGGAATGACCAGTGAT
GACTACCGTGAGACCAACAGTGGTCAGGATATTGACACCTACTTTATCCCGGGTGGTAACCGTGCTTTTACTCCC
GGTCGCATCAACTACTATTTCAAGTTCAGCGGCCCCAGTGTTAGTGTGGATACCGCTTGCTCCTCAAGTCTTGCG
GCAATTCATGTCGCCTGCAATTCCTTGTGGAGGAATGAATGTGATTCTGCCGTGACGGGCGGTGTCAACATCCTG
GCAAATCCCGACAATCATGCTGGTCTTGATCGTGGACACTTCCTCTCAAGGACCGGAAACTGTACCACCTTTGAT
GATGGGGCTGATGGCTATTGCAGAGCAGATGGAGTTGGCTCCATTGTCATTAAGAGACTTGAGGATGCCCAGGCA
GACAACGATCCAATCTACGGTATTATTGGAGGAGCTTATACCAACCACTCAGCAGAGGCTGTGTCAATTACTCGG
CCTCATGTGGGAGCACAGTCCTTCATCTTCGACAAGCTTCTCAACGAGTCCAACAGCGACCCAAAAGAGATTAGT
TATATCGAAATGCACGGAACCGGCACCCAGGCAGGTGATGCAGTGGAGATGCAGTCGGTTCTCGATGTCTTCGCT
CCTGACTACCGTCGTGGGCCAACCCAATCTCTTCACCTCGGTTCAGCAAAGTCAAATGTTGGCCATGGAGAGTCC
GCCTCTGGTGTCACAGCTCTGATCAAGGTCTTGATGATGATGCGAAAGAACATGATTCCCCCTCACTGTGGCATC
AAGACCAAGATCAACCACAACTTCCCGACAGACTTCCCGCAGCGCAATGTGCACATTGCATCTGAAGCTGTCCCC
TGGAACAGGCCAAATGGTGGCAAGCGGAAGACTTTCATCAACAATTTCTCGGCCGCCGGAGGCAATACTGCTTTG
ATGGTCGAGGATGGTCCGCTCAATGACGAGAATGTGGAAGATATCCGGTCTGCGCATCCTGTGCTTGTTTCGGCT
CGGTCCCAGTCTGCACTGAAGAATAACATCTCTGCTCTCGTGCAGTACATCGATACAAACAAGAACTCGTTCAAT
TCCAACGATGCAAGCCTCCTTGCCAATCTGTCTTACACGACTACAGCGAGACGGATTCATCATCCCTTCAGAGTC
GCTGTCACTGGATCTACTCTAGATGAAGTCAGGAGTGCATTGGCTCCTATCGTCAACCGAGACAGCATCAGCCCG
GCTCCTGCCAATGCACCTGGCATCGGATTTATCTTCACCGGACAAGGTGCTCAGTACACAGGCATGGGACGCCAA
TTGTTTGATAGTTGCTCCCAATTCCGTGCTCACATCGAACACTTGAATTGTATCTGTGAGAGCCAGGGCTTCCCA
TCTATTCTGTCCCTGGTCGACGGGAGTGTGCCAATTGAAGAGCATAGCCCGATCGTTACACAGCTCGGAACAACC
TGTGTGCAAATGGCATTGACAAAGTACTGGATGTCTCTGGGTATTGTACCTACCTTTGTCATTGGCCATAGCCTC
GGCGAGTTTGCCGCGCTGAATGCTTCCGGTGTCTTGACAACTAGCGACACAATCTACCTTGCCGGGCGACGAGCC
CAGCTTCTCACTGAACAAATCGAGGTTGGAACGCACGCTATGCTTGCTGTCAAGTCTTCAGTGGCACAGGTCAAG
CAGTTTCTTGATGAGGCTACCGAGGTGGCTTGTATCAATGCGCCCAGCGAGACTGTTATCAGTGGCGCAAGCGAG
AAGATTGACGAGCTTGCGCAAACTCTTACCAACGAAGGGTTCAAGGCTACCAAGTTAAATGTACCTTTTGCTTTC
CATTCAGCTCAGGTTGAACCTATACTTGAAAGTCTGGCTGAAATTGGAAAGGGCGTCAATTTCAACGCGCCCTCT
ATTCCATTCGTATCTGCCCTTCTTGGAGACGTCATCAATGAGACCAACGGTGAGTTGCTTGGTACCAACTACCTC
ACCCGTCACTGCCGGGAGACTGTCAACTTCCTGGGTGCTCTTGAAGCTACCCGGCACTCCAACTTAATGAATGAC
AAGACTATTTGGGTTGAGATTGGCTCTCACCCGGTCTGCTCCGGAATGGTCAAGGCAACTTTCGGTCCTCAGGCA
ACTACTGTGGCATCTCTCCGTCGCCAGGAAGACACGTGGAAGGTTCTCTCAACCAGTGTTTCAGCTCTCTATATG
GCTGGAATTGACATTCGATGGAAGGAATATCACCAGGACTTCACTGGACACAAAGTTCTCCCACTCCCTTCCTAC
AAGTGGGATCTCAAGAACTACTGGATTCCTTACACTAATAACTTCTGTCTGCTCAAGGGTGCACCGCCGGTATCA
GTGGCTGATGCTGCGCCAGTTTCTGTTTTCTTGTCATCGGCAGCACAAAAGGTTTTGGAGACGAGTGGTGACAAT
TCGTCGGCGTCTATCGTCATCGAGAATGACATTGCTGATCCCGACCTCAATCGTGTCATTGCAGGTCACAAGGTG
AACGGTGCCTGCCTTACTCCATCGTCCCTGTACGCCGATATCGCCCAAACACTTGGTGAATATCTAGTCCAGAAC
TACAAGCCAGAATGGAAAGATCGCGGATTTGATGTCTGCAACATGGTGGTCCCTAAGCCGCTTATTGCAAAGGGA
GGCAAGCAGCTCTTCCGCGTTTCAGCGACTGCAAACTGGGCCGAAGAAAATGCCAAGGTGCAGGTGTGGTCTGTG
ACCCCCGAGGGGAAGAAGATCCTTGACCACGCCACTTGCTACATCAAGTTCTTTGATCCCAGTACTTACGACGTC
GAGTGGAAGCGCAGCTCTTACCTCATCAAGCGAAGCATTGAGCATCTCCAAGAGAGCACTGTATCCGGCCAGGCT
CACCGCATGAAGCGAGGAATGGTCTACAAGCTCTTTGCTTCTCTGGTTGATTATGACGAGAACTACAAATCCATT
CGGGAAGTCATCCTCGACAGTGACCAACACGAAGCTACCGCTCTGGTCAAATTTGAGGCTCCTCCGGGCAACTTT
CATCGCAATCCATTCTGGATTGACAGCATTGGTCACTTGTCTGGCTTCATTATGAATGCTAGTGATAACACCGAT
TCGAAGAACCAAGTGTTCGTCAATCATGGATGGGACTCGATGAGGTGCTTGAAGAAGTTCGATCCGAGCGTCACT
TACCGCACCTACGTGAGGATGCAACCCTGGAAAGAGTCTATTTGGGCTGGTGATGTCTATATGTTTGATGGAGAT
GACATCGTTGCTGTGTTTGGTGGTGTTAAGTTCCAAGCTCTGGCACGAAAGATCCTCGACATGGCTCTTCCTCCA
GCTGGAGCGGCATCCAAGCCGGCCGCCAAGCGTGTTCCTGCTCCCGTCAATATCGAGAAGGCAAAGACTGGCTCT
GCCAAAAAGGCTGCCCCTTCACCAAGATCTGGAATGCCAAGTCTGACTATGCGTGCTCTTGCAATCCTTGCTGAA
GAGGTCGGACTTTCGGCATCTGAGCTGACTGATGACCTCAACTTCGCTGATTACGGAGTTGACTCCCTTCTCTCG
CTGACTGTCACTGGGCGATACCGCGAGGACATGGGACTCGATCTTGACTCCACTATCTTCGTGGATAATCCAACT
GTCAAAGACTTCAAAAATCTTCTAGCTCAAATGAGCCCTAGTGAAAGTAGTGACGGATCAAGCAGTGAAGGTGAC
ATGTCGTCGGCCGCATCTTCGACCGACTTGTCGACTCCAAACAGCAGTGGTCTGCCAAGTCCTGCAAATGAGAAG
CCGATGGCACATGGATCGCAGGAGCAAAATGACAGCATGAGGCAGATTGCCTCAATCTTGGCCGAGGAGATCGGT
GTGGAACCCGAGGAGCTCGATGGGGATGCGAACCTTGCTGAGATGGGCCTAGACTCATTGATGTCGCTCACCGTT
CTCGGTAAAATCCGTGAAGATCTTGATCTTGATCTCTCGGGAGAGTTCTTCATTGAGAATCAAACACTCGATGAT
ATCGAGACTACCTTGGGTCTAAAGCCTAAGCCAGCCCCTGCGGAGCCAATCAGATTCCCCGAACAAATCCCTGTT
CGAGCCCCGGTGGTCGCTCCCAGCACTACCCCCCAGCACCCGCCGGCCACTTCAATCCTCCTGCAAGGAAACCCA
AAGACAGCGACTCAGAGTTTGTTTTTGTTCCCTGATGGCTCTGGCTCTGCTACCTCCTATGCTTCCATCCCTGGA
ATTTCTCCCGATGTGTGTGTCTATGGACTGAACTGCCCATACATGCGCACCCCTGAGAATCTCAAGGCCAGATTG
GACGAGCTCACAGCTCCTTACATTGCTGAGATTCGGCGCCGCCAGCCCACTGGCCCTTACAACTTCGGTGGCTGG
TCCGCCGGTGGTATTTGTGCGTACGACGCCGCGCGCCAACTGATCTTCGAGGAAGGCGAGCGAGTCGAGCGCCTG
CTGCTTCTTGATTCGCCCTTCCCCGTTGGACTGGAGAAGCTGCCTCGCCGCCTGTACAGCTTCTTTGATACGGTC
GGACTGTTTGGAGAGGGCAAGGCACCTCCACCTAAATGGCTTCTCCCTCACTTCCTGGCTTTCATCGATTCCCTG
GATGCTTACAAGGCGGTTCCCTTCCCTCACACAGACCCCAAGCTGGCCGATAAGCTCCCCAAGACCTTCATGGTC
TGGGCCAAGGATGGTGTCTGCTCCAAGCCAGGTGATGCCCGCCCTGCACCAGCTGCAGATGGTAGCCCAGACCCT
CGTGAGATGCTCTGGTTGTTGAACAACCGCACTGATCTCGGTCCAAATGGTTGGGATACCCTCGTCGGCCCGAAT
CATGTCGGCGGAATTACCGTTATGGAGGATGCCAATCATTTCACTATGACTCGTGGCGAGAAGGCCAAGGAGCTG
GCTACATTCATTGCTAACTCTATGGCTTCGGCGTAA
Transcript >Pro_DTO377G3_2|g6432.t1
ATGGAGGGCCCCAGTCATTTGTATCTCTTTGGAGATCAGACTGCGGATTTTGACTCCGGGCTTCGTCGGCTGTTG
CATGCTAAGAATGACTCGCTTGTAGCAGCATTCTTCCAAAAGTGCTACTATGCGTTACGCAAGGAAATTACATCG
CTTCCGCCATCCGAACGTCAGGGCTTCCCTCGCTTTACTAGTATCGTTGACCTTCTCGCGAGGTTCAAAGAGTCA
GGGCCGAACCCAGCTCTAGAGAGTGCATTGACAACAATTTACCAACTAGGATGCTTCATCCACTACTATGGTGAT
TTGGGCCATGCCTATCCGTCGGGTGATGACAGCTGCATCATTGGACTTTGCACCGGTCAACTCGCATCTGCGGCC
GTAAGCTCTTCGAAAACTATCGGGGAGCTTATTGCAGCTGGAATTGAGACCGTCCTTGTTTCCTTGAGGCTCGGG
ATGTGCGTTTTGAAAGTACAAGAGCTCATAGAACCAAGCAAATCGGCAACATCAAGCTGGTCTGTACTAATTTCT
GGTATGCACGAGCCCGAGGCCCAGGATTTGATTCAACAGTACACGAAGAAGAATGCCTTGCCCCGCGTTTCTCAA
CCTTATATCAGCGCAGTAAGCCCCAATGGACTCACAATCAGTGGTCCCCCGACTTTTCTGGGCCGTTTCATTGAG
TCCAGTCTCTCAAAGGAGCACAAGCCCACAATGGTTCCAATCCACGGCCCTTATCATGCCTCTCATCTATATGAT
AACAGGGACATTAACCGAATTTTGGAATCGTGGCCTACAGAGAATTTCATGATGTACGTGCCTCAGATCCCTGTG
CTGTCAAGTGAGACAGGCAAGGAGCTCCAGGCTGAGAGCCTTGAGCAGCTCTTGAGATTTTCTCTTCAGGAGATT
CTACAAAGACAGCTTTGCTGGGGCAAGGTCATCCAATCTTGCCAGTCAATCTTGGAGTCTACAAAAACATGCACT
CTGTTCCCAATTTCCAGCACTGCAACCCAGAGCCTATTTAACTCATTGAAAAAGGCTGGAGTCTCCAATCTCGAG
GTTGACAGCACACTTGGTGATGTCCGGAAGGATGCTGGTGGAGATAATCGTACCGGCCGTGCTGAGCAGTCCAAA
ATTGCAATTATTGGTCTTTCAGGAAGATTTCCAGATTCGCCTGATACCGAAGCTTTCTGGGATCTTTTGAAAAAA
GGACTGGACGTCCACCGCGAGGTTCCCCCAGAGCGATGGGATGTCAAGGCTCACGTTGACATGGAAGGAAAGAAA
AGAAATACCAGCCAAGTCCAATATGGATGCTGGTATGACGACGCGGGCATGTTTGACCCTCGATTTTTCAATATG
TCTCCCCGTGAAGCACTTCAAGCAGATCCTGCTCAACGTCTGGCACTCTTGACTGCTTATGAGGCTTTGGAAATG
GCAGGCTTCATCCCTGACAGCACGCCCTCTACGCAGAAGAACCGAGTGGGTGTCTTCTATGGAATGACCAGTGAT
GACTACCGTGAGACCAACAGTGGTCAGGATATTGACACCTACTTTATCCCGGGTGGTAACCGTGCTTTTACTCCC
GGTCGCATCAACTACTATTTCAAGTTCAGCGGCCCCAGTGTTAGTGTGGATACCGCTTGCTCCTCAAGTCTTGCG
GCAATTCATGTCGCCTGCAATTCCTTGTGGAGGAATGAATGTGATTCTGCCGTGACGGGCGGTGTCAACATCCTG
GCAAATCCCGACAATCATGCTGGTCTTGATCGTGGACACTTCCTCTCAAGGACCGGAAACTGTACCACCTTTGAT
GATGGGGCTGATGGCTATTGCAGAGCAGATGGAGTTGGCTCCATTGTCATTAAGAGACTTGAGGATGCCCAGGCA
GACAACGATCCAATCTACGGTATTATTGGAGGAGCTTATACCAACCACTCAGCAGAGGCTGTGTCAATTACTCGG
CCTCATGTGGGAGCACAGTCCTTCATCTTCGACAAGCTTCTCAACGAGTCCAACAGCGACCCAAAAGAGATTAGT
TATATCGAAATGCACGGAACCGGCACCCAGGCAGGTGATGCAGTGGAGATGCAGTCGGTTCTCGATGTCTTCGCT
CCTGACTACCGTCGTGGGCCAACCCAATCTCTTCACCTCGGTTCAGCAAAGTCAAATGTTGGCCATGGAGAGTCC
GCCTCTGGTGTCACAGCTCTGATCAAGGTCTTGATGATGATGCGAAAGAACATGATTCCCCCTCACTGTGGCATC
AAGACCAAGATCAACCACAACTTCCCGACAGACTTCCCGCAGCGCAATGTGCACATTGCATCTGAAGCTGTCCCC
TGGAACAGGCCAAATGGTGGCAAGCGGAAGACTTTCATCAACAATTTCTCGGCCGCCGGAGGCAATACTGCTTTG
ATGGTCGAGGATGGTCCGCTCAATGACGAGAATGTGGAAGATATCCGGTCTGCGCATCCTGTGCTTGTTTCGGCT
CGGTCCCAGTCTGCACTGAAGAATAACATCTCTGCTCTCGTGCAGTACATCGATACAAACAAGAACTCGTTCAAT
TCCAACGATGCAAGCCTCCTTGCCAATCTGTCTTACACGACTACAGCGAGACGGATTCATCATCCCTTCAGAGTC
GCTGTCACTGGATCTACTCTAGATGAAGTCAGGAGTGCATTGGCTCCTATCGTCAACCGAGACAGCATCAGCCCG
GCTCCTGCCAATGCACCTGGCATCGGATTTATCTTCACCGGACAAGGTGCTCAGTACACAGGCATGGGACGCCAA
TTGTTTGATAGTTGCTCCCAATTCCGTGCTCACATCGAACACTTGAATTGTATCTGTGAGAGCCAGGGCTTCCCA
TCTATTCTGTCCCTGGTCGACGGGAGTGTGCCAATTGAAGAGCATAGCCCGATCGTTACACAGCTCGGAACAACC
TGTGTGCAAATGGCATTGACAAAGTACTGGATGTCTCTGGGTATTGTACCTACCTTTGTCATTGGCCATAGCCTC
GGCGAGTTTGCCGCGCTGAATGCTTCCGGTGTCTTGACAACTAGCGACACAATCTACCTTGCCGGGCGACGAGCC
CAGCTTCTCACTGAACAAATCGAGGTTGGAACGCACGCTATGCTTGCTGTCAAGTCTTCAGTGGCACAGGTCAAG
CAGTTTCTTGATGAGGCTACCGAGGTGGCTTGTATCAATGCGCCCAGCGAGACTGTTATCAGTGGCGCAAGCGAG
AAGATTGACGAGCTTGCGCAAACTCTTACCAACGAAGGGTTCAAGGCTACCAAGTTAAATGTACCTTTTGCTTTC
CATTCAGCTCAGGTTGAACCTATACTTGAAAGTCTGGCTGAAATTGGAAAGGGCGTCAATTTCAACGCGCCCTCT
ATTCCATTCGTATCTGCCCTTCTTGGAGACGTCATCAATGAGACCAACGGTGAGTTGCTTGGTACCAACTACCTC
ACCCGTCACTGCCGGGAGACTGTCAACTTCCTGGGTGCTCTTGAAGCTACCCGGCACTCCAACTTAATGAATGAC
AAGACTATTTGGGTTGAGATTGGCTCTCACCCGGTCTGCTCCGGAATGGTCAAGGCAACTTTCGGTCCTCAGGCA
ACTACTGTGGCATCTCTCCGTCGCCAGGAAGACACGTGGAAGGTTCTCTCAACCAGTGTTTCAGCTCTCTATATG
GCTGGAATTGACATTCGATGGAAGGAATATCACCAGGACTTCACTGGACACAAAGTTCTCCCACTCCCTTCCTAC
AAGTGGGATCTCAAGAACTACTGGATTCCTTACACTAATAACTTCTGTCTGCTCAAGGGTGCACCGCCGGTATCA
GTGGCTGATGCTGCGCCAGTTTCTGTTTTCTTGTCATCGGCAGCACAAAAGGTTTTGGAGACGAGTGGTGACAAT
TCGTCGGCGTCTATCGTCATCGAGAATGACATTGCTGATCCCGACCTCAATCGTGTCATTGCAGGTCACAAGGTG
AACGGTGCCTGCCTTACTCCATCGTCCCTGTACGCCGATATCGCCCAAACACTTGGTGAATATCTAGTCCAGAAC
TACAAGCCAGAATGGAAAGATCGCGGATTTGATGTCTGCAACATGGTGGTCCCTAAGCCGCTTATTGCAAAGGGA
GGCAAGCAGCTCTTCCGCGTTTCAGCGACTGCAAACTGGGCCGAAGAAAATGCCAAGGTGCAGGTGTGGTCTGTG
ACCCCCGAGGGGAAGAAGATCCTTGACCACGCCACTTGCTACATCAAGTTCTTTGATCCCAGTACTTACGACGTC
GAGTGGAAGCGCAGCTCTTACCTCATCAAGCGAAGCATTGAGCATCTCCAAGAGAGCACTGTATCCGGCCAGGCT
CACCGCATGAAGCGAGGAATGGTCTACAAGCTCTTTGCTTCTCTGGTTGATTATGACGAGAACTACAAATCCATT
CGGGAAGTCATCCTCGACAGTGACCAACACGAAGCTACCGCTCTGGTCAAATTTGAGGCTCCTCCGGGCAACTTT
CATCGCAATCCATTCTGGATTGACAGCATTGGTCACTTGTCTGGCTTCATTATGAATGCTAGTGATAACACCGAT
TCGAAGAACCAAGTGTTCGTCAATCATGGATGGGACTCGATGAGGTGCTTGAAGAAGTTCGATCCGAGCGTCACT
TACCGCACCTACGTGAGGATGCAACCCTGGAAAGAGTCTATTTGGGCTGGTGATGTCTATATGTTTGATGGAGAT
GACATCGTTGCTGTGTTTGGTGGTGTTAAGTTCCAAGCTCTGGCACGAAAGATCCTCGACATGGCTCTTCCTCCA
GCTGGAGCGGCATCCAAGCCGGCCGCCAAGCGTGTTCCTGCTCCCGTCAATATCGAGAAGGCAAAGACTGGCTCT
GCCAAAAAGGCTGCCCCTTCACCAAGATCTGGAATGCCAAGTCTGACTATGCGTGCTCTTGCAATCCTTGCTGAA
GAGGTCGGACTTTCGGCATCTGAGCTGACTGATGACCTCAACTTCGCTGATTACGGAGTTGACTCCCTTCTCTCG
CTGACTGTCACTGGGCGATACCGCGAGGACATGGGACTCGATCTTGACTCCACTATCTTCGTGGATAATCCAACT
GTCAAAGACTTCAAAAATCTTCTAGCTCAAATGAGCCCTAGTGAAAGTAGTGACGGATCAAGCAGTGAAGGTGAC
ATGTCGTCGGCCGCATCTTCGACCGACTTGTCGACTCCAAACAGCAGTGGTCTGCCAAGTCCTGCAAATGAGAAG
CCGATGGCACATGGATCGCAGGAGCAAAATGACAGCATGAGGCAGATTGCCTCAATCTTGGCCGAGGAGATCGGT
GTGGAACCCGAGGAGCTCGATGGGGATGCGAACCTTGCTGAGATGGGCCTAGACTCATTGATGTCGCTCACCGTT
CTCGGTAAAATCCGTGAAGATCTTGATCTTGATCTCTCGGGAGAGTTCTTCATTGAGAATCAAACACTCGATGAT
ATCGAGACTACCTTGGGTCTAAAGCCTAAGCCAGCCCCTGCGGAGCCAATCAGATTCCCCGAACAAATCCCTGTT
CGAGCCCCGGTGGTCGCTCCCAGCACTACCCCCCAGCACCCGCCGGCCACTTCAATCCTCCTGCAAGGAAACCCA
AAGACAGCGACTCAGAGTTTGTTTTTGTTCCCTGATGGCTCTGGCTCTGCTACCTCCTATGCTTCCATCCCTGGA
ATTTCTCCCGATGTGTGTGTCTATGGACTGAACTGCCCATACATGCGCACCCCTGAGAATCTCAAGGCCAGATTG
GACGAGCTCACAGCTCCTTACATTGCTGAGATTCGGCGCCGCCAGCCCACTGGCCCTTACAACTTCGGTGGCTGG
TCCGCCGGTGGTATTTGTGCGTACGACGCCGCGCGCCAACTGATCTTCGAGGAAGGCGAGCGAGTCGAGCGCCTG
CTGCTTCTTGATTCGCCCTTCCCCGTTGGACTGGAGAAGCTGCCTCGCCGCCTGTACAGCTTCTTTGATACGGTC
GGACTGTTTGGAGAGGGCAAGGCACCTCCACCTAAATGGCTTCTCCCTCACTTCCTGGCTTTCATCGATTCCCTG
GATGCTTACAAGGCGGTTCCCTTCCCTCACACAGACCCCAAGCTGGCCGATAAGCTCCCCAAGACCTTCATGGTC
TGGGCCAAGGATGGTGTCTGCTCCAAGCCAGGTGATGCCCGCCCTGCACCAGCTGCAGATGGTAGCCCAGACCCT
CGTGAGATGCTCTGGTTGTTGAACAACCGCACTGATCTCGGTCCAAATGGTTGGGATACCCTCGTCGGCCCGAAT
CATGTCGGCGGAATTACCGTTATGGAGGATGCCAATCATTTCACTATGACTCGTGGCGAGAAGGCCAAGGAGCTG
GCTACATTCATTGCTAACTCTATGGCTTCGGCGTAA
Gene >Pro_DTO377G3_2|g6432.t1
ATGGAGGGCCCCAGTCATTTGTATCTCTTTGGAGATCAGACTGCGGATTTTGACTCCGGGCTTCGTCGGCTGTTG
CATGCTAAGAATGACTCGCTTGTAGCAGCATTCTTCCAAAAGTGCTACTATGCGTTACGCAAGGAAATTACATCG
CTTCCGCCATCCGAACGTCAGGGCTTCCCTCGCTTTACTAGTATCGTTGACCTTCTCGCGAGGTTCAAAGAGTCA
GGGCCGAACCCAGCTCTAGAGAGTGCATTGACAACAATTTACCAACTAGGATGCTTCATCCAGTAAGAATATTGC
CGCCTTGATGATATCGAGATGAGATTTTGGAATCAAACTTACTGACAATGTCTTATAGCTACTATGGTGATTTGG
GCCATGCCTATCCGTCGGGTGATGACAGCTGCATCATTGGACTTTGCACCGGTCAACTCGCATCTGCGGCCGTAA
GCTCTTCGAAAACTATCGGGGAGCTTATTGCAGCTGGAATTGAGACCGTCCTTGTTTCCTTGAGGCTCGGGATGT
GCGTTTTGAAAGTACAAGAGCTCATAGAACCAAGCAAATCGGCAACATCAAGCTGGTCTGTACTAATTTCTGGTA
TGCACGAGCCCGAGGCCCAGGATTTGATTCAACAGTACACGAAGAAGAATGTAAGTCTTTTCCCCCAAACCGACT
TGAAATAAAAGAGGATCATTGTTAATATTTTCAAGGCCTTGCCCCGCGTTTCTCAACCTTATATCAGCGCAGTAA
GCCCCAATGGACTCACAATCAGTGGTCCCCCGACTTTTCTGGGCCGTTTCATTGAGTCCAGTCTCTCAAAGGAGC
ACAAGCCCACAATGGTTCCAATCCACGGCCCTTATCATGCCTCTCATCTATATGATAACAGGGACATTAACCGAA
TTTTGGAATCGTGGCCTACAGAGAATTTCATGATGTACGTGCCTCAGATCCCTGTGCTGTCAAGTGAGACAGGCA
AGGAGCTCCAGGCTGAGAGCCTTGAGCAGCTCTTGAGATTTTCTCTTCAGGAGATTCTACAAAGACAGCTTTGCT
GGGGCAAGGTCATCCAATCTTGCCAGTCAATCTTGGAGTCTACAAAAACATGCACTCTGTTCCCAATTTCCAGCA
CTGCAACCCAGAGCCTATTTAACTCATTGAAAAAGGCTGGAGTCTCCAATCTCGAGGTTGACAGCACACTTGGTG
ATGTCCGGAAGGATGCTGGTGGAGATAATCGTACCGGCCGTGCTGAGCAGTCCAAAATTGCAATTATTGGTCTTT
CAGGAAGATTTCCAGATTCGCCTGATACCGAAGCTTTCTGGGATCTTTTGAAAAAAGGACTGGACGTCCACCGCG
AGGTTCCCCCAGAGCGATGGGATGTCAAGGCTCACGTTGACATGGAAGGAAAGAAAAGAAATACCAGCCAAGTCC
AATATGGATGCTGGTATGACGACGCGGGCATGTTTGACCCTCGATTTTTCAATATGTCTCCCCGTGAAGCACTTC
AAGCAGATCCTGCTCAACGTCTGGCACTCTTGACTGCTTATGAGGCTTTGGAAATGGCAGGCTTCATCCCTGACA
GCACGCCCTCTACGCAGAAGAACCGAGTGGGTGTCTTCTATGGAATGACCAGTGATGACTACCGTGAGACCAACA
GTGGTCAGGATATTGACACCTACTTTATCCCGGGTGGTAACCGTGCTTTTACTCCCGGTCGCATCAACTACTATT
TCAAGTTCAGCGGCCCCAGTGTTAGTGTGGATACCGCTTGCTCCTCAAGTCTTGCGGCAATTCATGTCGCCTGCA
ATTCCTTGTGGAGGAATGAATGTGATTCTGCCGTGACGGGCGGTGTCAACATCCTGGCAAATCCCGACAATCATG
CTGGTCTTGATCGTGGACACTTCCTCTCAAGGACCGGAAACTGTACCACCTTTGATGATGGGGCTGATGGCTATT
GCAGAGCAGATGGAGTTGGCTCCATTGTCATTAAGAGACTTGAGGATGCCCAGGCAGACAACGATCCAATCTACG
GTATTATTGGAGGAGCTTATACCAACCACTCAGCAGAGGCTGTGTCAATTACTCGGCCTCATGTGGGAGCACAGT
CCTTCATCTTCGACAAGCTTCTCAACGAGTCCAACAGCGACCCAAAAGAGATTAGTTATATCGAAATGCACGGAA
CCGGCACCCAGGCAGGTGATGCAGTGGAGATGCAGTCGGTTCTCGATGTCTTCGCTCCTGACTACCGTCGTGGGC
CAACCCAATCTCTTCACCTCGGTTCAGCAAAGTCAAATGTTGGCCATGGAGAGTCCGCCTCTGGTGTCACAGCTC
TGATCAAGGTCTTGATGATGATGCGAAAGAACATGATTCCCCCTCACTGTGGCATCAAGACCAAGATCAACCACA
ACTTCCCGACAGACTTCCCGCAGCGCAATGTGCACATTGCATCTGAAGCTGTCCCCTGGAACAGGCCAAATGGTG
GCAAGCGGAAGACTTTCATCAACAATTTCTCGGCCGCCGGAGGCAATACTGCTTTGATGGTCGAGGATGGTCCGC
TCAATGACGAGAATGTGGAAGATATCCGGTCTGCGCATCCTGTGCTTGTTTCGGCTCGGTCCCAGTCTGCACTGA
AGAATAACATCTCTGCTCTCGTGCAGTACATCGATACAAACAAGAACTCGTTCAATTCCAACGATGCAAGCCTCC
TTGCCAATCTGTCTTACACGACTACAGCGAGACGGATTCATCATCCCTTCAGAGTCGCTGTCACTGGATCTACTC
TAGATGAAGTCAGGAGTGCATTGGCTCCTATCGTCAACCGAGACAGCATCAGCCCGGCTCCTGCCAATGCACCTG
GCATCGGATTTATCTTCACCGGACAAGGTGCTCAGTACACAGGCATGGGACGCCAATTGTTTGATAGTTGCTCCC
AATTCCGTGCTCACATCGAACACTTGAATTGTATCTGTGAGAGCCAGGGCTTCCCATCTATTCTGTCCCTGGTCG
ACGGGAGTGTGCCAATTGAAGAGCATAGCCCGATCGTTACACAGCTCGGAACAACCTGTGTGCAAATGGCATTGA
CAAAGTACTGGATGTCTCTGGGTATTGTACCTACCTTTGTCATTGGCCATAGCCTCGGCGAGTTTGCCGCGCTGA
ATGCTTCCGGTGTCTTGACAACTAGCGACACAATCTACCTTGCCGGGCGACGAGCCCAGCTTCTCACTGAACAAA
TCGAGGTTGGAACGCACGCTATGCTTGCTGTCAAGTCTTCAGTGGCACAGGTCAAGCAGTTTCTTGATGAGGCTA
CCGAGGTGGCTTGTATCAATGCGCCCAGCGAGACTGTTATCAGTGGCGCAAGCGAGAAGATTGACGAGCTTGCGC
AAACTCTTACCAACGAAGGGTTCAAGGCTACCAAGTTAAATGTACCTTTTGCTTTCCATTCAGCTCAGGTTGAAC
CTATACTTGAAAGTCTGGCTGAAATTGGAAAGGGCGTCAATTTCAACGCGCCCTCTATTCCATTCGTATCTGCCC
TTCTTGGAGACGTCATCAATGAGACCAACGGTGAGTTGCTTGGTACCAACTACCTCACCCGTCACTGCCGGGAGA
CTGTCAACTTCCTGGGTGCTCTTGAAGCTACCCGGCACTCCAACTTAATGAATGACAAGACTATTTGGGTTGAGA
TTGGCTCTCACCCGGTCTGCTCCGGAATGGTCAAGGCAACTTTCGGTCCTCAGGCAACTACTGTGGCATCTCTCC
GTCGCCAGGAAGACACGTGGAAGGTTCTCTCAACCAGTGTTTCAGCTCTCTATATGGCTGGAATTGACATTCGAT
GGAAGGAATATCACCAGGACTTCACTGGACACAAAGTTCTCCCACTCCCTTCCTACAAGTGGGATCTCAAGAACT
ACTGGATTCCTTACACTAATAACTTCTGTCTGCTCAAGGGTGCACCGCCGGTATCAGTGGCTGATGCTGCGCCAG
TTTCTGTTTTCTTGTCATCGGCAGCACAAAAGGTTTTGGAGACGAGTGGTGACAATTCGTCGGCGTCTATCGTCA
TCGAGAATGACATTGCTGATCCCGACCTCAATCGTGTCATTGCAGGTCACAAGGTGAACGGTGCCTGCCTTACTC
CATCGGTATGCATATTCTTTTCTCATTTAACAGTCTTGCTTGCTAATTGATTTTTAGTCCCTGTACGCCGATATC
GCCCAAACACTTGGTGAATATCTAGTCCAGAACTACAAGCCAGAATGGAAAGATCGCGGATTTGATGTCTGCAAC
ATGGTGGTCCCTAAGCCGCTTATTGCAAAGGGAGGCAAGCAGCTCTTCCGCGTTTCAGCGACTGCAAACTGGGCC
GAAGAAAATGCCAAGGTGCAGGTGTGGTCTGTGACCCCCGAGGGGAAGAAGATCCTTGACCACGCCACTTGCTAC
ATCAAGTTCTTTGATCCCAGTACTTACGACGTCGAGTGGAAGCGCAGCTCTTACCTCATCAAGCGAAGCATTGAG
CATCTCCAAGAGAGCACTGTATCCGGCCAGGCTCACCGCATGAAGCGAGGAATGGTCTACAAGCTCTTTGCTTCT
CTGGTTGATTATGACGAGAACTACAAATCCATTCGGGAAGTCATCCTCGACAGTGACCAACACGAAGCTACCGCT
CTGGTCAAATTTGAGGCTCCTCCGGGCAACTTTCATCGCAATCCATTCTGGATTGACAGCATTGGTCACTTGTCT
GGCTTCATTATGAATGCTAGTGATAACACCGATTCGAAGAACCAAGTGTTCGTCAATCATGGATGGGACTCGATG
AGGTGCTTGAAGAAGTTCGATCCGAGCGTCACTTACCGCACCTACGTGAGGATGCAACCCTGGAAAGAGTCTATT
TGGGCTGGTGATGTCTATATGTTTGATGGAGATGACATCGTTGCTGTGTTTGGTGGTGTTAAGGTACGTCGAAAA
ACCGTCGTAGTATTCTCGAATGAAACACTAACAGAATGCGACATAGTTCCAAGCTCTGGCACGAAAGATCCTCGA
CATGGCTCTTCCTCCAGCTGGAGCGGCATCCAAGCCGGCCGCCAAGCGTGTTCCTGCTCCCGTCAATATCGAGAA
GGCAAAGACTGGCTCTGCCAAAAAGGCTGCCCCTTCACCAAGATCTGGAATGCCAAGTCTGACTATGCGTGCTCT
TGCAATCCTTGCTGAAGAGGTCGGACTTTCGGCATCTGAGCTGACTGATGACCTCAACTTCGCTGATTACGGAGT
TGACTCCCTTCTCTCGCTGACTGTCACTGGGCGATACCGCGAGGACATGGGACTCGATCTTGACTCCACTATCTT
CGTGGATAATCCAACTGTCAAAGACTTCAAAAATCTTCTAGCTCAAATGAGCCCTAGTGAAAGTAGTGACGGATC
AAGCAGTGAAGGTGACATGTCGTCGGCCGCATCTTCGACCGACTTGTCGACTCCAAACAGCAGTGGTCTGCCAAG
TCCTGCAAATGAGAAGCCGATGGCACATGGATCGCAGGAGCAAAATGACAGCATGAGGCAGATTGCCTCAATCTT
GGCCGAGGAGATCGGTGTGGAACCCGAGGAGCTCGATGGGGATGCGAACCTTGCTGAGATGGGCCTAGACTCATT
GATGTCGCTCACCGTTCTCGGTAAAATCCGTGAAGATCTTGATCTTGATCTCTCGGGAGAGTTCTTCATTGAGAA
TCAAACACTCGATGATATCGAGACTACCTTGGGTCTAAAGCCTAAGCCAGCCCCTGCGGAGCCAATCAGATTCCC
CGAACAAATCCCTGTTCGAGCCCCGGTGGTCGCTCCCAGCACTACCCCCCAGCACCCGCCGGCCACTTCAATCCT
CCTGCAAGGAAACCCAAAGACAGCGACTCAGAGTTTGTTTTTGTTCCCTGATGGCTCTGGCTCTGCTACCTCCTA
TGCTTCCATCCCTGGAATTTCTCCCGATGTGTGTGTCTATGGACTGAACTGCCCATACATGCGCACCCCTGAGAA
TCTCAAGGCCAGATTGGACGAGCTCACAGCTCCTTACATTGCTGAGATTCGGCGCCGCCAGCCCACTGGCCCTTA
CAACTTCGGTGGCTGGTCCGCCGGTGGTATTTGTGCGTACGACGCCGCGCGCCAACTGATCTTCGAGGAAGGCGA
GCGAGTCGAGCGCCTGCTGCTTCTTGATTCGCCCTTCCCCGTTGGACTGGAGAAGCTGCCTCGCCGCCTGTACAG
CTTCTTTGATACGGTCGGACTGTTTGGAGAGGGCAAGGCACCTCCACCTAAATGGCTTCTCCCTCACTTCCTGGC
TTTCATCGATTCCCTGGATGCTTACAAGGCGGTTCCCTTCCCTCACACAGACCCCAAGCTGGCCGATAAGCTCCC
CAAGACCTTCATGGTCTGGGCCAAGGATGGTGTCTGCTCCAAGCCAGGTGATGCCCGCCCTGCACCAGCTGCAGA
TGGTAGCCCAGACCCTCGTGAGATGCTCTGGTTGTTGAACAACCGCACTGATCTCGGTCCAAATGGTTGGGATAC
CCTCGTCGGCCCGAATCATGTCGGCGGAATTACCGTTATGGAGGATGCCAATCATTTCACTATGACTCGTGGCGA
GAAGGCCAAGGAGCTGGCTACATTCATTGCTAACTCTATGGCTTCGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail