Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6426.t1
Gene name
Locationscaffold_17:161255..162619
Strand+
Gene length (bp)1364
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09296 NUDIX-like NADH pyrophosphatase-like rudimentary NUDIX domain 8.2E-20 57 194
PF00293 NUDIX NUDIX domain 7.4E-17 257 365
PF09297 zf-NADH-PPase NADH pyrophosphatase zinc ribbon domain 7.8E-06 197 223

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016787 hydrolase activity Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 40.23 22.81 57.64
5d_25C Five days - 25 degrees Celsius 31.58 17.09 46.08
7d_25C Seven days - 25 degrees Celsius 29.50 15.71 43.29
10d_25C Ten days - 25 degrees Celsius 29.51 15.72 43.30
7d_15C Seven days - 15 degrees Celsius 40.25 22.69 57.80
7d_30C Seven days - 30 degrees Celsius 34.86 19.23 50.48

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.376975 no
3d_25C 7d_25C 0.226837 no
3d_25C 7d_15C 0.998423 no
3d_25C 7d_30C 0.635666 no
3d_25C 10d_25C 0.228923 no
5d_25C 7d_25C 0.857806 no
5d_25C 7d_15C 0.386010 no
5d_25C 7d_30C 0.778988 no
5d_25C 10d_25C 0.859826 no
7d_25C 7d_15C 0.233813 no
7d_25C 7d_30C 0.585051 no
7d_25C 10d_25C 0.999109 no
7d_15C 7d_30C 0.648441 no
7d_15C 10d_25C 0.242576 no
7d_30C 10d_25C 0.598319 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6426.t1
MSTTALIPAPAHTLADSMLSRHFGKETVNYFSSSPINRLSFLRSDHPFLSSALKHPSTRFVLLNNLAPLTPSPSQ
LYYAKYDDVRKLVPQDIFDKSEEDMIKNYDSRKTHPTLIFLGLDESHKEGGLTYKIYSGTPYFAVDVTPKGPEEQ
QTAAKDIIAAMEAKGLSFFQTRVVMSFSADEAAIYAQARALMDWNTRNTFCGTCGHRTLAVNAGTKRACPPTDVA
LGIEGKLEERPECNTRTTLSNLSFPRTDPTIIVAVVSADGKRVLLGRSKRFPPGWYSTLAGFIEPAESIEDAVRR
EVWEESGVTLSRVVIHSSQPWPYPANLMIGAIAQVSDPAHETISLLHDPELEDARWFEIEEVQEALRIGTSDLSG
PAGPEYKGGLRLPPPTAIANQLIQAAVSAEYFAADKQSKM*
Coding >Pro_DTO377G3_2|g6426.t1
ATGAGCACGACTGCCCTGATCCCCGCCCCGGCTCATACGCTCGCGGATTCAATGTTGTCCCGACACTTTGGCAAA
GAGACGGTTAATTACTTCTCCAGTTCTCCAATCAATCGTCTATCTTTCTTGCGCTCCGACCACCCGTTCCTGTCC
AGTGCTCTAAAGCACCCTTCGACCCGATTTGTACTGTTGAACAACCTAGCGCCCTTGACTCCGTCACCGTCGCAG
CTATACTATGCCAAGTATGACGATGTACGCAAGCTTGTTCCCCAGGATATCTTCGATAAATCCGAGGAAGACATG
ATCAAGAACTATGACTCGCGCAAGACACACCCGACCCTTATATTCCTCGGACTGGACGAGAGTCACAAGGAAGGG
GGTCTGACGTACAAGATCTACTCTGGCACGCCGTATTTTGCAGTCGACGTGACCCCCAAGGGACCTGAAGAGCAG
CAGACTGCAGCGAAGGATATAATCGCTGCCATGGAGGCGAAGGGACTGTCATTCTTCCAAACACGAGTTGTCATG
TCCTTCTCCGCAGATGAAGCTGCTATCTATGCACAAGCACGTGCGCTGATGGACTGGAACACTCGCAACACCTTC
TGTGGTACATGCGGCCACCGTACTTTGGCCGTGAATGCAGGAACCAAGCGTGCCTGTCCACCGACGGATGTTGCA
CTAGGAATTGAGGGCAAGTTGGAAGAGCGGCCGGAGTGCAATACCCGCACTACGCTGTCAAACCTTTCCTTCCCC
CGTACCGATCCGACTATCATTGTTGCGGTGGTCTCCGCTGATGGCAAGCGGGTCCTCCTCGGGCGCTCCAAGCGC
TTCCCGCCAGGGTGGTATTCCACCTTGGCTGGATTCATCGAGCCAGCGGAGTCAATCGAGGATGCCGTGCGGAGA
GAGGTGTGGGAAGAATCCGGCGTCACTTTGTCCCGCGTTGTTATCCACTCCTCGCAGCCTTGGCCGTATCCGGCC
AATTTGATGATTGGTGCTATTGCCCAGGTCAGTGACCCCGCTCACGAGACCATCTCTTTACTGCATGACCCTGAG
TTGGAGGATGCGCGGTGGTTTGAAATTGAGGAGGTGCAAGAGGCGCTGCGCATTGGTACAAGTGACTTGAGTGGT
CCGGCTGGTCCAGAATACAAGGGCGGTTTGCGATTGCCCCCTCCTACGGCTATTGCCAATCAGTTGATTCAGGCT
GCTGTCAGCGCAGAGTATTTTGCGGCAGATAAGCAGTCTAAGATGTAA
Transcript >Pro_DTO377G3_2|g6426.t1
ATGAGCACGACTGCCCTGATCCCCGCCCCGGCTCATACGCTCGCGGATTCAATGTTGTCCCGACACTTTGGCAAA
GAGACGGTTAATTACTTCTCCAGTTCTCCAATCAATCGTCTATCTTTCTTGCGCTCCGACCACCCGTTCCTGTCC
AGTGCTCTAAAGCACCCTTCGACCCGATTTGTACTGTTGAACAACCTAGCGCCCTTGACTCCGTCACCGTCGCAG
CTATACTATGCCAAGTATGACGATGTACGCAAGCTTGTTCCCCAGGATATCTTCGATAAATCCGAGGAAGACATG
ATCAAGAACTATGACTCGCGCAAGACACACCCGACCCTTATATTCCTCGGACTGGACGAGAGTCACAAGGAAGGG
GGTCTGACGTACAAGATCTACTCTGGCACGCCGTATTTTGCAGTCGACGTGACCCCCAAGGGACCTGAAGAGCAG
CAGACTGCAGCGAAGGATATAATCGCTGCCATGGAGGCGAAGGGACTGTCATTCTTCCAAACACGAGTTGTCATG
TCCTTCTCCGCAGATGAAGCTGCTATCTATGCACAAGCACGTGCGCTGATGGACTGGAACACTCGCAACACCTTC
TGTGGTACATGCGGCCACCGTACTTTGGCCGTGAATGCAGGAACCAAGCGTGCCTGTCCACCGACGGATGTTGCA
CTAGGAATTGAGGGCAAGTTGGAAGAGCGGCCGGAGTGCAATACCCGCACTACGCTGTCAAACCTTTCCTTCCCC
CGTACCGATCCGACTATCATTGTTGCGGTGGTCTCCGCTGATGGCAAGCGGGTCCTCCTCGGGCGCTCCAAGCGC
TTCCCGCCAGGGTGGTATTCCACCTTGGCTGGATTCATCGAGCCAGCGGAGTCAATCGAGGATGCCGTGCGGAGA
GAGGTGTGGGAAGAATCCGGCGTCACTTTGTCCCGCGTTGTTATCCACTCCTCGCAGCCTTGGCCGTATCCGGCC
AATTTGATGATTGGTGCTATTGCCCAGGTCAGTGACCCCGCTCACGAGACCATCTCTTTACTGCATGACCCTGAG
TTGGAGGATGCGCGGTGGTTTGAAATTGAGGAGGTGCAAGAGGCGCTGCGCATTGGTACAAGTGACTTGAGTGGT
CCGGCTGGTCCAGAATACAAGGGCGGTTTGCGATTGCCCCCTCCTACGGCTATTGCCAATCAGTTGATTCAGGCT
GCTGTCAGCGCAGAGTATTTTGCGGCAGATAAGCAGTCTAAGATGTAA
Gene >Pro_DTO377G3_2|g6426.t1
ATGAGCACGACTGCCCTGATCCCCGCCCCGGCTCATACGCTCGCGGATTCAATGTTGTCCCGACACTTTGGCAAA
GAGACGGTTAATTACTTCTCCAGTAAGGATGTCTTGGACTCTTGTATATGAGGCACAGTAGGGCTAAAGTATCTC
TAGGTTCTCCAATCAATCGTCTATCTTTCTTGCGCTCCGACCACCCGTTCCTGTCCAGTGCTCTAAAGCACCCTT
CGACCCGATTTGTACTGTTGAACAACCTAGCGCCCTTGACTCCGTCACCGTCGCAGCTATACTATGCCAAGTATG
ACGATGTACGCAAGCTTGTTCCCCAGGATATCTTCGATAAATCCGAGGAAGACATGATCAAGAACTATGACTCGC
GCAAGACACACCCGACCCTTATATTCCTCGGACTGGACGAGAGTCACAAGGAAGGGGGTCTGACGTACAAGATCT
ACTCTGGCACGCCGTATTTTGCAGTCGACGTGACCCCCAAGGGACCTGAAGAGCAGCAGACTGCAGCGAAGGATA
TAATCGCTGCCATGGAGGCGAAGGGACTGTCATTCTTCCAAACACGAGTTGTCATGTCCTTCTCCGCAGATGAAG
GTATGAAGATGCGATCTTAATGTCTGCATCTATAAGAGGAAACTAATCAACTCGGGATAGCTGCTATCTATGCAC
AAGCACGTGCGCTGATGGACTGGAACACTCGCAACACCTTCTGTGGTACATGCGGCCACCGTACTTTGGCCGTGA
ATGCAGGAACCAAGCGTGCCTGTCCACCGACGGATGTTGCACTAGGAATTGAGGGCAAGTTGGAAGAGCGGCCGG
AGTGCAATACCCGCACTACGCTGTCAAACCTTTCCTTCCCCCGTACCGATCCGACTATCATTGTTGCGGTGGTCT
CCGCTGATGGCAAGCGGGTCCTCCTCGGGCGCTCCAAGCGCTTCCCGCCAGGGTGGTATTCCACCTTGGCTGGAT
TCATCGAGCCAGCGGAGTCAATCGAGGATGCCGTGCGGAGAGAGGTGTGGGAAGAATCCGGCGTCACTTTGTCCC
GCGTTGTTATCCACTCCTCGCAGCCTTGGCCGTATCCGGCCAATTTGATGATTGGTGCTATTGCCCAGGTCAGTG
ACCCCGCTCACGAGACCATCTCTTTACTGCATGACCCTGAGTTGGAGGATGCGCGGTGGTTTGAAATTGAGGAGG
TGCAAGAGGCGCTGCGCATTGGTACAAGTGACTTGAGTGGTCCGGCTGGTCCAGAATACAAGGGCGGTTTGCGAT
TGCCCCCTCCTACGGCTATTGCCAATCAGTTGATTCAGGCTGCTGTCAGCGCAGAGTATTTTGCGGCAGATAAGC
AGTCTAAGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail