Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6401.t1
Gene name
Locationscaffold_17:93729..97971
Strand-
Gene length (bp)4242
Transcript length (bp)4179
Coding sequence length (bp)4179
Protein length (aa) 1393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17846 XRN_M Xrn1 helical domain 5.8E-99 275 666
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 1.2E-96 1 227
PF18332 XRN1_D1 Exoribonuclease Xrn1 D1 domain 2.3E-73 717 904
PF18334 XRN1_D2_D3 Exoribonuclease Xrn1 D2/D3 domain 7.6E-32 909 993
PF18129 SH3_12 Xrn1 SH3-like domain 3.3E-23 1149 1219
PF18194 Xrn1_D3 Exoribonuclease 1 Domain-3 1.4E-07 1076 1140

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0004527 exonuclease activity Yes
GO:0097159 organic cyclic compound binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0004518 nuclease activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6401.t1
MGVPKFFRWLSERYPSISMLIAESRIPEFDSLYLDMNGIIHNCTHSDSDSPTFRMTEDQMFIAIFNYIEHLFGKI
KPKKLFYMAVDGVAPRAKMNQQRARRFRTALDAENAKEKAIQQGLEMPKEDAFDSNCITPGTEFMQKLTKQLKYF
INKKISEDTDWQGVEIVLSGHEVPGEGEHKIMEYIRCSKAQPDYESNVRHCLYGLDADLIMLGLLSHDPHFCLLR
EEVTFGRQVSKKPKELEHQNFYLLHLSVVREYLELEFQELEQDGVLDFPFDMERVIDDFILMAFFVGNDFLPNLP
NLHINEGALALMFKLYKEVLPKMGGYINEQGVINVQRLGMLVTALSAVEYRFFEAENSDAQWIKSKKDPSIDYST
SQQKKELTLTPAQKEILKTVKKYVLNRSDKTCEPLDLPPTLPARDRAFVEQLADELRLPWSSIDNENGDRFMRLT
LPPTQCDSDDEEDEEASVAVQRIIRKYEKAKVQEMTPEEAQKSAQEKYDAKFLEWKDNYYRTKFGWGLDNKEEMK
KLAQNYVQGLQWVLFYYYRGIASWPWFFQYHYAPMISDVNDGLGADMDFKLGQPFRPFDQLMGVLPDRSKKIVPT
AYWDLMTSADSPIYDFYPRDFDLDMNGKKMEWEAVVKIPFIDEKRLLDALKTKENLLSADEKARNDFGVCLKFTY
SPEVNFIYPSSMPGVFPDLPSCRCIENLFDLPVMDGLVPYAGLMDGVHLGKAALAGFPSIKTLPHHGQLGFHGVC
VFNQDSRNESQVITLLDPGSRSSIELAKTKLGKRIHVGYPFLQEALVVRVSDELFDYVLPPGEQHPLSIPHTPQQ
IEQWKRKANKIEGTYSKRLAIIIGDVESLVHIQLLKGMSKTDDGATIKEFADIPGQETDYALQVVVDDVINPDQR
FIEREALSIQEEFPEGSRAFFLGDFNYGRPVYVGGHEDGKVNGLVAAVKGREPEFGRERVRASEQLCPYMPSYAV
ARSLRLNPLVLAKITSSFTVDIEGQRANLGLNLKFQAKQQKVLGYSRRGQSGWEFSQKAVELLQQYMIKFPEFIA
GIQRNPQSDRYSPTDFYPEEIAALKMKEIKDWLKSIEAKNFERVPLDAEQLDSDIVMLIEQDADNLNASQPDMQP
KKVRGVPRSALLRPADVEHRLGNQTFQLGDRVVYAQDSGKVPIATRGTVVGLTRTPRALLLDVVFDVSFMSGTTL
GGRCSPFRGQTVLASSLLNISNRQLITSSRATASQQTQQTQTPLTVAGYGAPIGPHGQGQLRNATAPPPLRGSFR
GAVAGQGNGQGNGAGRGGRGGLNNGQQTTLPFRPNGGGIPRGPRAGRGGARGGYVAMDNSDPSEGIIQNNPNFRP
QNYSRVPPPQGLDRGRGRGRGRGNGFRGRGGRGRGGAPQPTA*
Coding >Pro_DTO377G3_2|g6401.t1
ATGGGTGTCCCGAAATTCTTCCGTTGGCTGAGTGAGCGGTATCCGTCAATCTCGATGCTGATCGCAGAGAGCCGG
ATACCCGAATTCGATAGCCTATACCTCGACATGAACGGTATTATTCACAACTGTACACATAGTGACAGCGACTCC
CCGACGTTTCGCATGACGGAGGATCAAATGTTCATTGCCATCTTCAATTACATTGAACATCTATTTGGCAAAATC
AAGCCCAAGAAACTGTTCTACATGGCGGTAGACGGTGTTGCGCCTCGCGCTAAGATGAATCAACAACGTGCGCGT
CGATTCCGGACGGCCCTGGATGCAGAGAATGCGAAGGAGAAGGCTATCCAGCAGGGCCTGGAGATGCCAAAGGAA
GATGCCTTTGACAGCAACTGCATCACCCCGGGTACCGAGTTCATGCAGAAATTGACGAAACAACTCAAATACTTC
ATCAACAAGAAAATCTCGGAGGACACAGATTGGCAAGGTGTGGAAATTGTGCTTTCTGGCCATGAGGTTCCCGGA
GAAGGCGAGCACAAGATTATGGAATACATTCGCTGCTCGAAAGCGCAGCCCGACTATGAATCCAACGTTCGCCAT
TGTCTTTACGGTCTGGATGCCGATCTGATCATGCTGGGTCTCCTCAGCCATGACCCTCACTTCTGTCTTCTTCGA
GAGGAAGTGACCTTTGGTCGCCAAGTATCCAAGAAGCCCAAAGAATTGGAACACCAAAACTTTTACCTCCTGCAT
CTGAGCGTGGTGCGGGAGTATTTGGAACTAGAATTCCAAGAGCTAGAACAAGATGGTGTTCTGGATTTCCCATTC
GATATGGAGCGTGTCATTGATGATTTCATTCTTATGGCCTTTTTCGTTGGCAACGATTTCTTGCCCAACCTGCCA
AACTTACATATCAACGAGGGTGCCCTTGCCCTTATGTTCAAGCTCTACAAGGAGGTGCTGCCAAAAATGGGCGGC
TACATCAACGAGCAGGGTGTTATTAACGTGCAACGGTTGGGCATGCTTGTGACTGCGCTTAGTGCCGTGGAATAC
CGATTCTTTGAGGCTGAAAACTCCGATGCCCAATGGATCAAATCGAAGAAAGACCCAAGCATTGATTATTCGACC
TCGCAACAGAAGAAAGAGCTTACGCTCACTCCTGCTCAGAAGGAGATACTTAAGACGGTCAAGAAGTACGTTCTG
AACCGGTCTGATAAGACCTGTGAACCCCTTGACCTCCCTCCTACACTTCCAGCTCGTGACCGCGCTTTCGTCGAA
CAGCTTGCGGATGAGCTCCGGTTGCCTTGGTCCTCCATCGACAACGAGAACGGTGATCGATTCATGAGACTCACA
TTGCCTCCAACCCAGTGTGACAGTGATGACGAAGAGGACGAAGAGGCATCGGTGGCTGTTCAGCGTATTATTCGG
AAGTACGAGAAGGCCAAAGTTCAAGAGATGACTCCCGAGGAAGCACAGAAGTCCGCGCAGGAGAAATATGATGCC
AAGTTTTTAGAGTGGAAAGATAATTATTATCGGACCAAGTTCGGCTGGGGCCTCGATAACAAAGAAGAGATGAAG
AAGTTGGCGCAAAACTACGTGCAAGGATTGCAGTGGGTCTTGTTCTACTATTACCGTGGCATTGCTTCTTGGCCT
TGGTTCTTCCAGTACCACTATGCCCCTATGATTTCTGATGTGAATGATGGTCTTGGTGCAGACATGGACTTCAAA
TTGGGACAGCCTTTCCGGCCGTTCGACCAGCTTATGGGTGTCTTGCCCGATCGCAGCAAGAAGATCGTGCCTACT
GCGTATTGGGACCTGATGACCTCGGCTGATTCCCCCATCTACGATTTCTACCCCCGTGATTTTGATCTGGATATG
AACGGAAAAAAGATGGAATGGGAAGCCGTTGTCAAGATTCCATTCATCGACGAAAAACGGCTTTTGGACGCCCTC
AAAACGAAAGAAAACCTACTTTCCGCGGATGAAAAAGCAAGGAACGACTTTGGGGTTTGTCTCAAATTCACCTAT
TCCCCAGAAGTGAACTTCATTTACCCCTCCTCAATGCCTGGCGTATTCCCGGATCTTCCTAGCTGCCGTTGTATT
GAGAACCTCTTTGACCTCCCCGTCATGGATGGATTGGTGCCCTACGCTGGCTTAATGGACGGCGTCCACTTAGGC
AAGGCAGCGCTTGCTGGCTTCCCTAGCATCAAGACACTTCCGCACCATGGTCAATTAGGTTTCCATGGCGTTTGC
GTGTTCAATCAAGATAGCCGCAACGAGAGCCAGGTTATTACACTCCTTGATCCGGGAAGCCGGTCGAGCATTGAA
CTGGCTAAGACGAAGCTTGGGAAGCGTATTCACGTGGGTTATCCATTCTTACAAGAAGCTCTTGTGGTCCGCGTT
TCGGATGAATTATTTGATTATGTTCTACCTCCTGGAGAACAACACCCTTTATCTATTCCTCATACCCCTCAGCAA
ATTGAGCAGTGGAAGAGGAAGGCCAACAAGATTGAGGGCACCTACAGCAAGCGTCTAGCAATTATCATTGGCGAT
GTCGAATCTCTGGTCCACATTCAACTTCTGAAGGGCATGAGCAAGACAGACGATGGAGCCACAATCAAGGAATTC
GCTGATATTCCCGGCCAAGAGACGGATTATGCTCTACAGGTTGTTGTTGATGATGTGATCAATCCTGATCAACGT
TTTATTGAGCGTGAAGCTCTCTCTATCCAAGAAGAATTCCCAGAGGGTTCTCGTGCCTTCTTCTTGGGTGATTTC
AACTATGGAAGACCTGTTTATGTTGGGGGACACGAAGACGGAAAGGTGAATGGATTGGTCGCGGCTGTGAAGGGT
CGGGAGCCAGAATTCGGTCGAGAGCGTGTTAGGGCATCTGAGCAACTCTGCCCCTACATGCCGTCGTACGCTGTT
GCGCGCAGTCTTCGCCTCAATCCTTTGGTCCTAGCCAAGATCACATCTTCCTTTACAGTTGATATCGAAGGCCAA
CGTGCGAACCTCGGTCTTAACCTGAAGTTCCAGGCAAAGCAACAGAAGGTTCTTGGATACTCCCGTCGAGGACAA
TCTGGCTGGGAATTTAGCCAAAAGGCAGTGGAACTGCTTCAACAGTACATGATTAAATTCCCCGAATTCATCGCT
GGAATCCAGCGCAACCCTCAAAGCGACCGTTATTCTCCGACTGATTTCTATCCAGAGGAAATCGCCGCCCTTAAG
ATGAAAGAGATTAAGGATTGGCTCAAATCTATTGAAGCTAAGAACTTCGAGAGAGTGCCCCTCGATGCTGAGCAA
CTTGACTCGGATATTGTGATGTTGATTGAGCAGGATGCCGATAATCTCAATGCGTCCCAGCCAGATATGCAACCG
AAGAAGGTTCGGGGTGTGCCCCGTAGTGCACTCCTTCGGCCTGCCGATGTCGAGCACCGCCTCGGAAACCAAACC
TTCCAGCTTGGTGATCGGGTTGTGTATGCCCAAGATTCTGGTAAGGTGCCAATCGCTACTCGTGGCACTGTTGTC
GGTTTAACCAGAACCCCACGAGCACTTCTGCTTGATGTTGTCTTTGATGTGTCGTTCATGAGCGGCACTACGCTA
GGTGGTCGATGCTCACCATTCCGTGGTCAAACTGTTTTAGCATCTTCCCTCCTCAACATCTCCAACCGACAACTG
ATCACTAGTTCCCGTGCCACAGCTAGCCAGCAAACCCAGCAAACCCAGACTCCTTTGACAGTTGCCGGATACGGC
GCACCCATCGGTCCTCACGGACAGGGACAACTGAGGAACGCAACTGCCCCTCCGCCCCTGAGAGGCTCTTTCCGA
GGAGCTGTCGCCGGACAAGGCAATGGACAAGGCAATGGAGCTGGACGTGGAGGTCGCGGGGGTCTCAACAACGGC
CAACAGACCACTCTTCCTTTCCGTCCCAATGGTGGCGGTATTCCCCGTGGCCCCCGTGCCGGTCGGGGAGGTGCG
CGAGGCGGATATGTCGCAATGGACAACAGCGATCCCAGCGAGGGTATTATCCAAAACAACCCCAACTTCCGTCCG
CAGAACTACTCTCGCGTTCCGCCGCCGCAAGGATTGGACCGAGGACGTGGCCGTGGCCGCGGTCGTGGTAATGGG
TTCCGTGGCAGAGGAGGTCGTGGGCGAGGAGGTGCCCCCCAGCCCACTGCCTAG
Transcript >Pro_DTO377G3_2|g6401.t1
ATGGGTGTCCCGAAATTCTTCCGTTGGCTGAGTGAGCGGTATCCGTCAATCTCGATGCTGATCGCAGAGAGCCGG
ATACCCGAATTCGATAGCCTATACCTCGACATGAACGGTATTATTCACAACTGTACACATAGTGACAGCGACTCC
CCGACGTTTCGCATGACGGAGGATCAAATGTTCATTGCCATCTTCAATTACATTGAACATCTATTTGGCAAAATC
AAGCCCAAGAAACTGTTCTACATGGCGGTAGACGGTGTTGCGCCTCGCGCTAAGATGAATCAACAACGTGCGCGT
CGATTCCGGACGGCCCTGGATGCAGAGAATGCGAAGGAGAAGGCTATCCAGCAGGGCCTGGAGATGCCAAAGGAA
GATGCCTTTGACAGCAACTGCATCACCCCGGGTACCGAGTTCATGCAGAAATTGACGAAACAACTCAAATACTTC
ATCAACAAGAAAATCTCGGAGGACACAGATTGGCAAGGTGTGGAAATTGTGCTTTCTGGCCATGAGGTTCCCGGA
GAAGGCGAGCACAAGATTATGGAATACATTCGCTGCTCGAAAGCGCAGCCCGACTATGAATCCAACGTTCGCCAT
TGTCTTTACGGTCTGGATGCCGATCTGATCATGCTGGGTCTCCTCAGCCATGACCCTCACTTCTGTCTTCTTCGA
GAGGAAGTGACCTTTGGTCGCCAAGTATCCAAGAAGCCCAAAGAATTGGAACACCAAAACTTTTACCTCCTGCAT
CTGAGCGTGGTGCGGGAGTATTTGGAACTAGAATTCCAAGAGCTAGAACAAGATGGTGTTCTGGATTTCCCATTC
GATATGGAGCGTGTCATTGATGATTTCATTCTTATGGCCTTTTTCGTTGGCAACGATTTCTTGCCCAACCTGCCA
AACTTACATATCAACGAGGGTGCCCTTGCCCTTATGTTCAAGCTCTACAAGGAGGTGCTGCCAAAAATGGGCGGC
TACATCAACGAGCAGGGTGTTATTAACGTGCAACGGTTGGGCATGCTTGTGACTGCGCTTAGTGCCGTGGAATAC
CGATTCTTTGAGGCTGAAAACTCCGATGCCCAATGGATCAAATCGAAGAAAGACCCAAGCATTGATTATTCGACC
TCGCAACAGAAGAAAGAGCTTACGCTCACTCCTGCTCAGAAGGAGATACTTAAGACGGTCAAGAAGTACGTTCTG
AACCGGTCTGATAAGACCTGTGAACCCCTTGACCTCCCTCCTACACTTCCAGCTCGTGACCGCGCTTTCGTCGAA
CAGCTTGCGGATGAGCTCCGGTTGCCTTGGTCCTCCATCGACAACGAGAACGGTGATCGATTCATGAGACTCACA
TTGCCTCCAACCCAGTGTGACAGTGATGACGAAGAGGACGAAGAGGCATCGGTGGCTGTTCAGCGTATTATTCGG
AAGTACGAGAAGGCCAAAGTTCAAGAGATGACTCCCGAGGAAGCACAGAAGTCCGCGCAGGAGAAATATGATGCC
AAGTTTTTAGAGTGGAAAGATAATTATTATCGGACCAAGTTCGGCTGGGGCCTCGATAACAAAGAAGAGATGAAG
AAGTTGGCGCAAAACTACGTGCAAGGATTGCAGTGGGTCTTGTTCTACTATTACCGTGGCATTGCTTCTTGGCCT
TGGTTCTTCCAGTACCACTATGCCCCTATGATTTCTGATGTGAATGATGGTCTTGGTGCAGACATGGACTTCAAA
TTGGGACAGCCTTTCCGGCCGTTCGACCAGCTTATGGGTGTCTTGCCCGATCGCAGCAAGAAGATCGTGCCTACT
GCGTATTGGGACCTGATGACCTCGGCTGATTCCCCCATCTACGATTTCTACCCCCGTGATTTTGATCTGGATATG
AACGGAAAAAAGATGGAATGGGAAGCCGTTGTCAAGATTCCATTCATCGACGAAAAACGGCTTTTGGACGCCCTC
AAAACGAAAGAAAACCTACTTTCCGCGGATGAAAAAGCAAGGAACGACTTTGGGGTTTGTCTCAAATTCACCTAT
TCCCCAGAAGTGAACTTCATTTACCCCTCCTCAATGCCTGGCGTATTCCCGGATCTTCCTAGCTGCCGTTGTATT
GAGAACCTCTTTGACCTCCCCGTCATGGATGGATTGGTGCCCTACGCTGGCTTAATGGACGGCGTCCACTTAGGC
AAGGCAGCGCTTGCTGGCTTCCCTAGCATCAAGACACTTCCGCACCATGGTCAATTAGGTTTCCATGGCGTTTGC
GTGTTCAATCAAGATAGCCGCAACGAGAGCCAGGTTATTACACTCCTTGATCCGGGAAGCCGGTCGAGCATTGAA
CTGGCTAAGACGAAGCTTGGGAAGCGTATTCACGTGGGTTATCCATTCTTACAAGAAGCTCTTGTGGTCCGCGTT
TCGGATGAATTATTTGATTATGTTCTACCTCCTGGAGAACAACACCCTTTATCTATTCCTCATACCCCTCAGCAA
ATTGAGCAGTGGAAGAGGAAGGCCAACAAGATTGAGGGCACCTACAGCAAGCGTCTAGCAATTATCATTGGCGAT
GTCGAATCTCTGGTCCACATTCAACTTCTGAAGGGCATGAGCAAGACAGACGATGGAGCCACAATCAAGGAATTC
GCTGATATTCCCGGCCAAGAGACGGATTATGCTCTACAGGTTGTTGTTGATGATGTGATCAATCCTGATCAACGT
TTTATTGAGCGTGAAGCTCTCTCTATCCAAGAAGAATTCCCAGAGGGTTCTCGTGCCTTCTTCTTGGGTGATTTC
AACTATGGAAGACCTGTTTATGTTGGGGGACACGAAGACGGAAAGGTGAATGGATTGGTCGCGGCTGTGAAGGGT
CGGGAGCCAGAATTCGGTCGAGAGCGTGTTAGGGCATCTGAGCAACTCTGCCCCTACATGCCGTCGTACGCTGTT
GCGCGCAGTCTTCGCCTCAATCCTTTGGTCCTAGCCAAGATCACATCTTCCTTTACAGTTGATATCGAAGGCCAA
CGTGCGAACCTCGGTCTTAACCTGAAGTTCCAGGCAAAGCAACAGAAGGTTCTTGGATACTCCCGTCGAGGACAA
TCTGGCTGGGAATTTAGCCAAAAGGCAGTGGAACTGCTTCAACAGTACATGATTAAATTCCCCGAATTCATCGCT
GGAATCCAGCGCAACCCTCAAAGCGACCGTTATTCTCCGACTGATTTCTATCCAGAGGAAATCGCCGCCCTTAAG
ATGAAAGAGATTAAGGATTGGCTCAAATCTATTGAAGCTAAGAACTTCGAGAGAGTGCCCCTCGATGCTGAGCAA
CTTGACTCGGATATTGTGATGTTGATTGAGCAGGATGCCGATAATCTCAATGCGTCCCAGCCAGATATGCAACCG
AAGAAGGTTCGGGGTGTGCCCCGTAGTGCACTCCTTCGGCCTGCCGATGTCGAGCACCGCCTCGGAAACCAAACC
TTCCAGCTTGGTGATCGGGTTGTGTATGCCCAAGATTCTGGTAAGGTGCCAATCGCTACTCGTGGCACTGTTGTC
GGTTTAACCAGAACCCCACGAGCACTTCTGCTTGATGTTGTCTTTGATGTGTCGTTCATGAGCGGCACTACGCTA
GGTGGTCGATGCTCACCATTCCGTGGTCAAACTGTTTTAGCATCTTCCCTCCTCAACATCTCCAACCGACAACTG
ATCACTAGTTCCCGTGCCACAGCTAGCCAGCAAACCCAGCAAACCCAGACTCCTTTGACAGTTGCCGGATACGGC
GCACCCATCGGTCCTCACGGACAGGGACAACTGAGGAACGCAACTGCCCCTCCGCCCCTGAGAGGCTCTTTCCGA
GGAGCTGTCGCCGGACAAGGCAATGGACAAGGCAATGGAGCTGGACGTGGAGGTCGCGGGGGTCTCAACAACGGC
CAACAGACCACTCTTCCTTTCCGTCCCAATGGTGGCGGTATTCCCCGTGGCCCCCGTGCCGGTCGGGGAGGTGCG
CGAGGCGGATATGTCGCAATGGACAACAGCGATCCCAGCGAGGGTATTATCCAAAACAACCCCAACTTCCGTCCG
CAGAACTACTCTCGCGTTCCGCCGCCGCAAGGATTGGACCGAGGACGTGGCCGTGGCCGCGGTCGTGGTAATGGG
TTCCGTGGCAGAGGAGGTCGTGGGCGAGGAGGTGCCCCCCAGCCCACTGCCTAG
Gene >Pro_DTO377G3_2|g6401.t1
ATGGGTGTCCCGAAATTCTTCCGTTGGCTGAGTGAGCGGTATCCGTCAATCTCGATGCTGATCGCAGAGAGCCGG
ATACCCGAATTCGATAGCCTATACCTCGACATGAACGGTATTATTCACAACTGTACACATAGTGACAGCGACTCC
CCGACGTTTCGCATGACGGAGGATCAAATGTTCATTGCCATCTTCAATTACATTGAACATCTATTTGGCAAAATC
AAGCCCAAGAAACTGTTCTACATGGCGGTAGACGGTGTTGCGCCTCGCGCTAAGATGAATCAACAACGTGCGCGT
CGATTCCGGACGGCCCTGGATGCAGAGAATGCGAAGGAGAAGGCTATCCAGCAGGGCCTGGAGATGCCAAAGGAA
GATGCCTTTGACAGCAACTGCATCACCCCGGGTACCGAGTTCATGCAGAAATTGACGAAACAACTCAAATACTTC
ATCAACAAGAAAATCTCGGAGGACACAGATTGGCAAGGTGTGGAAATTGTGCTTTCTGGCCATGAGGTTCCCGGA
GAAGGCGAGCACAAGATTATGGAATACATTCGCTGCTCGAAAGCGCAGCCCGACTATGAATCCAACGTTCGCCAT
TGTCTTTACGGTCTGGATGCCGATCTGATCATGCTGGGTCTCCTCAGCCATGACCCTCACTTCTGTCTTCTTCGA
GAGGAAGTGACCTTTGGTCGCCAAGTATCCAAGAAGCCCAAAGAATTGGAACACCAAAACTTTTACCTCCTGCAT
CTGAGCGTGGTGCGGGAGTATTTGGAACTAGAATTCCAAGAGCTAGAACAAGATGGTGTTCTGGATTTCCCATTC
GATATGGAGCGTGTCATTGATGATTTCATTCTTATGGCCTTTTTCGTTGGCAACGATTTCTTGCCCAACCTGCCA
AACTTACATATCAACGAGGGTGCCCTTGCCCTTATGTTCAAGCTCTACAAGGAGGTGCTGCCAAAAATGGGCGGC
TACATCAACGAGCAGGGTGTTATTAACGTGCAACGGTTGGGCATGCTTGTGACTGCGCTTAGTGCCGTGGAATAC
CGATTCTTTGAGGCTGAAAACTCCGATGCCCAATGGATCAAATCGAAGAAAGACCCAAGCATTGATTATTCGACC
TCGCAACAGAAGAAAGAGCTTACGCTCACTCCTGCTCAGAAGGAGATACTTAAGACGGTCAAGAAGTACGTTCTG
AACCGGTCTGATAAGACCTGTGAACCCCTTGACCTCCCTCCTACACTTCCAGCTCGTGACCGCGCTTTCGTCGAA
CAGCTTGCGGATGAGCTCCGGTTGCCTTGGTCCTCCATCGACAACGAGAACGGTGATCGATTCATGAGACTCACA
TTGCCTCCAACCCAGTGTGACAGTGATGACGAAGAGGACGAAGAGGCATCGGTGGCTGTTCAGCGTATTATTCGG
AAGTACGAGAAGGCCAAAGTTCAAGAGATGACTCCCGAGGAAGCACAGAAGTCCGCGCAGGAGAAATATGATGCC
AAGTTTTTAGAGTGGAAAGATAATTATTATCGGACCAAGTTCGGCTGGGGCCTCGATAACAAAGAAGAGATGAAG
AAGTTGGCGCAAAACTACGTGCAAGGATTGCAGTGGGTCTTGTTCTACTATTACCGTGGCATTGCTTCTTGGCCT
TGGTTCTTCCAGTACCACTATGCCCCTATGATTTCTGGTTAGTAGTACCCAATCCCCCTTTTTTCTTGTTGGATT
ATTCTGATTGCTAACGGTTGAACAGATGTGAATGATGGTCTTGGTGCAGACATGGACTTCAAATTGGGACAGCCT
TTCCGGCCGTTCGACCAGCTTATGGGTGTCTTGCCCGATCGCAGCAAGAAGATCGTGCCTACTGCGTATTGGGAC
CTGATGACCTCGGCTGATTCCCCCATCTACGATTTCTACCCCCGTGATTTTGATCTGGATATGAACGGAAAAAAG
ATGGAATGGGAAGCCGTTGTCAAGATTCCATTCATCGACGAAAAACGGCTTTTGGACGCCCTCAAAACGAAAGAA
AACCTACTTTCCGCGGATGAAAAAGCAAGGAACGACTTTGGGGTTTGTCTCAAATTCACCTATTCCCCAGAAGTG
AACTTCATTTACCCCTCCTCAATGCCTGGCGTATTCCCGGATCTTCCTAGCTGCCGTTGTATTGAGAACCTCTTT
GACCTCCCCGTCATGGATGGATTGGTGCCCTACGCTGGCTTAATGGACGGCGTCCACTTAGGCAAGGCAGCGCTT
GCTGGCTTCCCTAGCATCAAGACACTTCCGCACCATGGTCAATTAGGTTTCCATGGCGTTTGCGTGTTCAATCAA
GATAGCCGCAACGAGAGCCAGGTTATTACACTCCTTGATCCGGGAAGCCGGTCGAGCATTGAACTGGCTAAGACG
AAGCTTGGGAAGCGTATTCACGTGGGTTATCCATTCTTACAAGAAGCTCTTGTGGTCCGCGTTTCGGATGAATTA
TTTGATTATGTTCTACCTCCTGGAGAACAACACCCTTTATCTATTCCTCATACCCCTCAGCAAATTGAGCAGTGG
AAGAGGAAGGCCAACAAGATTGAGGGCACCTACAGCAAGCGTCTAGCAATTATCATTGGCGATGTCGAATCTCTG
GTCCACATTCAACTTCTGAAGGGCATGAGCAAGACAGACGATGGAGCCACAATCAAGGAATTCGCTGATATTCCC
GGCCAAGAGACGGATTATGCTCTACAGGTTGTTGTTGATGATGTGATCAATCCTGATCAACGTTTTATTGAGCGT
GAAGCTCTCTCTATCCAAGAAGAATTCCCAGAGGGTTCTCGTGCCTTCTTCTTGGGTGATTTCAACTATGGAAGA
CCTGTTTATGTTGGGGGACACGAAGACGGAAAGGTGAATGGATTGGTCGCGGCTGTGAAGGGTCGGGAGCCAGAA
TTCGGTCGAGAGCGTGTTAGGGCATCTGAGCAACTCTGCCCCTACATGCCGTCGTACGCTGTTGCGCGCAGTCTT
CGCCTCAATCCTTTGGTCCTAGCCAAGATCACATCTTCCTTTACAGTTGATATCGAAGGCCAACGTGCGAACCTC
GGTCTTAACCTGAAGTTCCAGGCAAAGCAACAGAAGGTTCTTGGATACTCCCGTCGAGGACAATCTGGCTGGGAA
TTTAGCCAAAAGGCAGTGGAACTGCTTCAACAGTACATGATTAAATTCCCCGAATTCATCGCTGGAATCCAGCGC
AACCCTCAAAGCGACCGTTATTCTCCGACTGATTTCTATCCAGAGGAAATCGCCGCCCTTAAGATGAAAGAGATT
AAGGATTGGCTCAAATCTATTGAAGCTAAGAACTTCGAGAGAGTGCCCCTCGATGCTGAGCAACTTGACTCGGAT
ATTGTGATGTTGATTGAGCAGGATGCCGATAATCTCAATGCGTCCCAGCCAGATATGCAACCGAAGAAGGTTCGG
GGTGTGCCCCGTAGTGCACTCCTTCGGCCTGCCGATGTCGAGCACCGCCTCGGAAACCAAACCTTCCAGCTTGGT
GATCGGGTTGTGTATGCCCAAGATTCTGGTAAGGTGCCAATCGCTACTCGTGGCACTGTTGTCGGTTTAACCAGA
ACCCCACGAGCACTTCTGCTTGATGTTGTCTTTGATGTGTCGTTCATGAGCGGCACTACGCTAGGTGGTCGATGC
TCACCATTCCGTGGTCAAACTGTTTTAGCATCTTCCCTCCTCAACATCTCCAACCGACAACTGATCACTAGTTCC
CGTGCCACAGCTAGCCAGCAAACCCAGCAAACCCAGACTCCTTTGACAGTTGCCGGATACGGCGCACCCATCGGT
CCTCACGGACAGGGACAACTGAGGAACGCAACTGCCCCTCCGCCCCTGAGAGGCTCTTTCCGAGGAGCTGTCGCC
GGACAAGGCAATGGACAAGGCAATGGAGCTGGACGTGGAGGTCGCGGGGGTCTCAACAACGGCCAACAGACCACT
CTTCCTTTCCGTCCCAATGGTGGCGGTATTCCCCGTGGCCCCCGTGCCGGTCGGGGAGGTGCGCGAGGCGGATAT
GTCGCAATGGACAACAGCGATCCCAGCGAGGGTATTATCCAAAACAACCCCAACTTCCGTCCGCAGAACTACTCT
CGCGTTCCGCCGCCGCAAGGATTGGACCGAGGACGTGGCCGTGGCCGCGGTCGTGGTAATGGGTTCCGTGGCAGA
GGAGGTCGTGGGCGAGGAGGTGCCCCCCAGCCCACTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail