Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g64.t1
Gene name
Locationscaffold_01:157998..159285
Strand-
Gene length (bp)1287
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03239 FTR1 Iron permease FTR1 family 1.2E-88 10 320

GO

GO Term Description Terminal node
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0033573 high-affinity iron permease complex Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0030001 metal ion transport No
GO:0098655 cation transmembrane transport No
GO:0046873 metal ion transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0055085 transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0031226 intrinsic component of plasma membrane No
GO:1990351 transporter complex No
GO:0051234 establishment of localization No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0098796 membrane protein complex No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0044459 plasma membrane part No
GO:0044464 cell part No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0098797 plasma membrane protein complex No
GO:0098660 inorganic ion transmembrane transport No
GO:1902494 catalytic complex No
GO:0005887 integral component of plasma membrane No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0000041 transition metal ion transport No
GO:0005575 cellular_component No
GO:1902495 transmembrane transporter complex No
GO:0022857 transmembrane transporter activity No
GO:0016021 integral component of membrane No
GO:1990204 oxidoreductase complex No
GO:0006826 iron ion transport No
GO:1905862 ferroxidase complex No
GO:0034220 ion transmembrane transport No
GO:0006812 cation transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 52 74 22
3 89 111 22
4 148 170 22
5 180 202 22
6 209 231 22
7 293 315 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g64.t1
MGNNKVFAVTVFFICFRECLETTVVVSVLLAFLKQSLYESDRPTYKRLVKQVWLGCALGLFICLAVGAGMIGAFY
GLGTDTFSSTEDIWEGVLGIIASIIITVMGAALLRVSKLQDKWRVKLAKALQHEHDPNETKKGRVKRWLEKYVMF
ILPFITVLREGLEAVVYVGGVGLGLPATSFPLAVFCGLLAGIAVGFVIYRGGRQTSMQIFLIISTCFLYLVAAGL
FSRGVWYLENNAWNNIIGGDASETGSGAGSYDIRQSVWHVNCCNPELGGGGGWGIFNALLGWTNSADYGSVISYN
LYWICVMIGYALMFYREKRGAIPIIDPAMNSVARAKAKTRAFILRRPYEDPVAPVETRGPASEKRAGTGVLALQI
*
Coding >Pro_DTO377G3_2|g64.t1
ATGGGCAATAACAAGGTCTTCGCTGTCACCGTGTTTTTTATCTGCTTCCGAGAATGTCTCGAGACGACGGTGGTC
GTGTCAGTTCTACTGGCATTCTTGAAACAATCGCTCTACGAGAGTGATCGCCCGACGTATAAAAGACTAGTGAAA
CAAGTCTGGCTGGGATGCGCCTTAGGTCTATTTATTTGTCTCGCAGTCGGAGCAGGTATGATTGGTGCTTTTTAC
GGCCTCGGAACGGACACATTCTCCAGCACCGAGGATATTTGGGAGGGTGTTCTGGGAATCATCGCATCGATCATC
ATCACTGTGATGGGCGCTGCCCTTCTGCGCGTGTCTAAACTTCAAGACAAATGGCGTGTCAAGCTCGCCAAGGCC
CTCCAACACGAGCACGATCCTAACGAGACAAAGAAGGGTCGCGTCAAGAGATGGTTGGAGAAATACGTCATGTTC
ATCCTGCCATTTATCACGGTTCTCCGTGAGGGTCTCGAAGCCGTTGTCTATGTTGGTGGTGTTGGATTAGGGCTC
CCTGCCACCTCCTTCCCCTTGGCCGTCTTTTGCGGCCTTTTGGCTGGTATCGCGGTGGGATTTGTTATCTACCGA
GGTGGACGGCAGACTTCGATGCAGATCTTCTTGATCATTTCCACTTGCTTCCTCTACCTCGTTGCCGCCGGTCTT
TTCTCGCGTGGTGTGTGGTACTTGGAGAACAACGCCTGGAACAACATCATCGGAGGCGACGCGTCGGAGACTGGC
TCTGGTGCCGGATCCTACGACATCCGACAGAGTGTCTGGCACGTGAACTGTTGTAACCCAGAGCTGGGAGGTGGC
GGCGGTTGGGGTATCTTCAACGCGCTTCTTGGTTGGACCAATTCGGCCGATTACGGCTCCGTGATCTCCTACAAC
TTATACTGGATCTGTGTCATGATTGGCTATGCGCTGATGTTCTACCGTGAGAAGCGTGGAGCTATCCCGATCATT
GACCCGGCTATGAACAGCGTCGCAAGGGCCAAGGCCAAGACGAGAGCCTTCATTCTGCGCCGTCCCTATGAAGAT
CCGGTAGCACCCGTTGAGACAAGAGGTCCCGCTTCGGAGAAGCGTGCAGGCACTGGTGTCTTGGCTCTTCAGATT
TAA
Transcript >Pro_DTO377G3_2|g64.t1
ATGGGCAATAACAAGGTCTTCGCTGTCACCGTGTTTTTTATCTGCTTCCGAGAATGTCTCGAGACGACGGTGGTC
GTGTCAGTTCTACTGGCATTCTTGAAACAATCGCTCTACGAGAGTGATCGCCCGACGTATAAAAGACTAGTGAAA
CAAGTCTGGCTGGGATGCGCCTTAGGTCTATTTATTTGTCTCGCAGTCGGAGCAGGTATGATTGGTGCTTTTTAC
GGCCTCGGAACGGACACATTCTCCAGCACCGAGGATATTTGGGAGGGTGTTCTGGGAATCATCGCATCGATCATC
ATCACTGTGATGGGCGCTGCCCTTCTGCGCGTGTCTAAACTTCAAGACAAATGGCGTGTCAAGCTCGCCAAGGCC
CTCCAACACGAGCACGATCCTAACGAGACAAAGAAGGGTCGCGTCAAGAGATGGTTGGAGAAATACGTCATGTTC
ATCCTGCCATTTATCACGGTTCTCCGTGAGGGTCTCGAAGCCGTTGTCTATGTTGGTGGTGTTGGATTAGGGCTC
CCTGCCACCTCCTTCCCCTTGGCCGTCTTTTGCGGCCTTTTGGCTGGTATCGCGGTGGGATTTGTTATCTACCGA
GGTGGACGGCAGACTTCGATGCAGATCTTCTTGATCATTTCCACTTGCTTCCTCTACCTCGTTGCCGCCGGTCTT
TTCTCGCGTGGTGTGTGGTACTTGGAGAACAACGCCTGGAACAACATCATCGGAGGCGACGCGTCGGAGACTGGC
TCTGGTGCCGGATCCTACGACATCCGACAGAGTGTCTGGCACGTGAACTGTTGTAACCCAGAGCTGGGAGGTGGC
GGCGGTTGGGGTATCTTCAACGCGCTTCTTGGTTGGACCAATTCGGCCGATTACGGCTCCGTGATCTCCTACAAC
TTATACTGGATCTGTGTCATGATTGGCTATGCGCTGATGTTCTACCGTGAGAAGCGTGGAGCTATCCCGATCATT
GACCCGGCTATGAACAGCGTCGCAAGGGCCAAGGCCAAGACGAGAGCCTTCATTCTGCGCCGTCCCTATGAAGAT
CCGGTAGCACCCGTTGAGACAAGAGGTCCCGCTTCGGAGAAGCGTGCAGGCACTGGTGTCTTGGCTCTTCAGATT
TAA
Gene >Pro_DTO377G3_2|g64.t1
ATGGGCAATAACAAGGTCTTCGCTGTCACCGGTATAGTTCATCTGCTTTTTGGAATACACAACTACTTACTAAAT
ATTCAATCAGTGTTTTTTATCTGCTTCCGAGAATGTCTCGAGACGACGGTGGTCGTGTCAGTTCTACTGGCATTC
TTGAAACAATCGCTCTACGAGAGTGATCGCCCGACGTATAAAAGACTAGTGAAACAAGTAAGCGACCGGCTCTTA
CACTCCTATGCAATTTCATCTGCTAAAACAAATAGGTCTGGCTGGGATGCGCCTTAGGTCTATTTATTTGTCTCG
CAGTCGGAGCAGGTATGATTGGTGCTTTTTACGGCCTCGGAACGGACACATTCTCCAGCACCGAGGATATTTGGG
AGGGTGTTCTGGGAATCATCGCATCGATCATCATCACTGTGATGGGCGCTGCCCTTCTGCGCGTGTCTAAACTTC
AAGACAAATGGCGTGTCAAGCTCGCCAAGGCCCTCCAACACGAGCACGATCCTAACGAGACAAAGAAGGGTCGCG
TCAAGAGATGGTTGGAGAAATACGTCATGTTCATCCTGCCATTTATCACGGTTCTCCGTGAGGGTCTCGAAGCCG
TTGTCTATGTTGGTGGTGTTGGATTAGGGCTCCCTGCCACCTCCTTCCCCTTGGCCGTCTTTTGCGGCCTTTTGG
CTGGTATCGCGGTGGGATTTGTTATCTACCGGTATGTCGATTCGATCGTCTTTGATAAATATACAGCGCTAACAT
ACCGATAGAGGTGGACGGCAGACTTCGATGCAGATCTTCTTGATCATTTCCACTTGCTTCCTCTACCTCGTTGCC
GCCGGTCTTTTCTCGCGTGGTGTGTGGTACTTGGAGAACAACGCCTGGAACAACATCATCGGAGGCGACGCGTCG
GAGACTGGCTCTGGTGCCGGATCCTACGACATCCGACAGAGTGTCTGGCACGTGAACTGTTGTAACCCAGAGCTG
GGAGGTGGCGGCGGTTGGGGTATCTTCAACGCGCTTCTTGGTTGGACCAATTCGGCCGATTACGGCTCCGTGATC
TCCTACAACTTATACTGGATCTGTGTCATGATTGGCTATGCGCTGATGTTCTACCGTGAGAAGCGTGGAGCTATC
CCGATCATTGACCCGGCTATGAACAGCGTCGCAAGGGCCAAGGCCAAGACGAGAGCCTTCATTCTGCGCCGTCCC
TATGAAGATCCGGTAGCACCCGTTGAGACAAGAGGTCCCGCTTCGGAGAAGCGTGCAGGCACTGGTGTCTTGGCT
CTTCAGATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail