Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6383.t1
Gene name
Locationscaffold_17:41584..43724
Strand-
Gene length (bp)2140
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03815 LCCL LCCL domain 7.4E-26 148 271

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 112 131 19
2 303 325 22
3 340 362 22
4 383 405 22
5 420 442 22
6 454 476 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 73.71 45.27 102.15
5d_25C Five days - 25 degrees Celsius 99.51 60.66 138.36
7d_25C Seven days - 25 degrees Celsius 110.45 66.63 154.27
10d_25C Ten days - 25 degrees Celsius 153.68 91.56 215.79
7d_15C Seven days - 15 degrees Celsius 103.09 61.98 144.19
7d_30C Seven days - 30 degrees Celsius 95.86 58.44 133.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.171568 no
3d_25C 7d_25C 0.052547 no
3d_25C 7d_15C 0.121948 no
3d_25C 7d_30C 0.243279 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.718403 no
5d_25C 7d_15C 0.918812 no
5d_25C 7d_30C 0.911607 no
5d_25C 10d_25C 0.041603 yes
7d_25C 7d_15C 0.827413 no
7d_25C 7d_30C 0.594967 no
7d_25C 10d_25C 0.143642 no
7d_15C 7d_30C 0.813452 no
7d_15C 10d_25C 0.070025 no
7d_30C 10d_25C 0.023673 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6383.t1
MFGEGREQAARLYVPPLLEDDERLNDPEASEDLPPPDVEAGSTLPVWLQESSKSFRWGWVPLPLRKVGRATVNWV
KGPDPPHMLLLKPLFPRFQELPVQYLDHFFPKRKFKTLLLLLLYLSWFLPWFLVLLHSRSSGYIEGYGRPQTLSC
STNFWEVDNGCGINGNDCRPFSSSTIPFRCPANCRDTKLLEPYVVGNNTYNYQGLVIGGPGPDGSDPALYRADSF
ICQAAIHVGAISNDGGCGVVKLEGAAHSFPSVKQHGILSAGFPSTFPKAFSFLQLSSPQASCPSDPRWTLLGITA
AAVGILWLFCTSPPVLFFSTFFMVFCHTGLVGDPPSYPFLADLVSSLLSRLLPASFVVYVLYKFCAAPLLQPISS
PIYQLSKLFLFLPPLFTGALNNYTFARLIPLQRLTPMDIQKQPGAKLALALVIPIVISIILSQAWQIRQGGLLPR
YLKIYGTMGVIILILLPLPGLRLRIHHYILAILLMPGTAFPTRPSLVYQGLLLGLFINGVARWGFASIIETPAAL
GEQAPLGDGIHGWWGATYPNITATSVNVSLPELDSNHTYRGNGNITFSLWEHDRMADLAVDGVSLLLNDVERWRG
YLDEDKRGEFTWHRHGHDGLELQTNPRLVNRDLDTNIEPRSVLLADSDPDDEPEDLFFRFAFLRGSEAGSYSPTG
VWLSDGAWWPPAPPKK*
Coding >Pro_DTO377G3_2|g6383.t1
ATGTTTGGAGAGGGCCGAGAGCAAGCCGCCAGGCTATATGTTCCTCCGCTGCTTGAGGATGACGAGCGTCTGAAC
GATCCCGAAGCTTCCGAAGACCTGCCGCCGCCGGACGTTGAGGCAGGCAGCACTCTTCCCGTCTGGTTGCAAGAA
TCATCCAAGTCGTTTCGCTGGGGATGGGTGCCGCTACCGCTCCGAAAGGTCGGTCGCGCCACCGTCAATTGGGTC
AAGGGTCCCGATCCCCCGCATATGCTTCTGTTGAAACCTCTGTTTCCGCGATTCCAGGAACTTCCAGTCCAATAC
CTTGACCATTTCTTCCCAAAGCGCAAATTTAAGACTTTACTCTTATTGCTGCTCTATTTATCTTGGTTCTTGCCT
TGGTTTTTGGTTTTATTACACTCGCGTTCTTCCGGTTATATCGAAGGTTACGGTCGGCCTCAGACGCTGTCCTGC
TCGACGAACTTCTGGGAGGTCGACAATGGATGTGGTATTAACGGAAACGACTGCCGTCCATTTTCTTCATCAACT
ATTCCCTTCCGGTGTCCTGCGAACTGCCGTGATACCAAATTACTGGAGCCTTACGTTGTGGGAAATAATACGTAC
AACTACCAAGGCCTAGTCATTGGAGGGCCTGGGCCGGATGGCTCCGACCCGGCACTTTACCGTGCGGATAGCTTT
ATCTGCCAGGCAGCAATCCATGTCGGTGCAATCTCCAACGATGGCGGATGCGGTGTCGTCAAGCTTGAAGGCGCA
GCGCACTCTTTCCCATCAGTCAAGCAACACGGTATTCTCTCTGCCGGGTTCCCATCGACATTCCCGAAGGCTTTC
AGCTTTCTCCAGCTATCCTCGCCACAAGCTAGCTGCCCCTCCGATCCACGCTGGACGCTTCTTGGAATCACTGCT
GCAGCAGTTGGCATCCTGTGGCTCTTCTGTACTTCACCGCCTGTGCTGTTTTTCAGTACATTCTTCATGGTGTTC
TGCCATACGGGACTTGTTGGAGATCCGCCCTCGTATCCTTTCTTGGCCGACCTTGTCTCCAGTCTTCTGTCACGA
CTGCTGCCAGCGTCGTTTGTTGTCTACGTACTTTACAAGTTCTGTGCTGCGCCGCTGTTGCAGCCGATATCCTCG
CCTATCTACCAGTTGTCAAAGTTGTTCCTTTTCCTACCTCCACTGTTCACTGGAGCCCTGAACAACTATACCTTT
GCGCGATTGATTCCATTGCAGCGTCTAACTCCAATGGACATTCAGAAACAACCGGGGGCAAAGTTGGCATTGGCT
CTCGTCATCCCAATTGTGATTTCGATTATCCTAAGCCAGGCGTGGCAAATTCGCCAGGGAGGTCTGCTCCCACGG
TATTTGAAGATATACGGTACCATGGGTGTCATCATCTTGATTTTGCTTCCCCTTCCTGGGCTTCGCCTTCGAATT
CACCATTATATCCTCGCCATTCTCCTCATGCCCGGCACCGCCTTTCCCACCCGGCCCTCGCTTGTCTACCAGGGT
CTGCTGCTGGGTCTTTTCATCAATGGAGTTGCGCGGTGGGGCTTCGCCTCAATTATCGAGACTCCGGCAGCCCTA
GGAGAGCAAGCGCCACTTGGAGATGGAATCCATGGCTGGTGGGGTGCTACCTATCCTAATATCACGGCCACATCC
GTGAATGTCTCCCTTCCAGAGTTGGATTCGAATCACACTTATCGCGGCAATGGTAACATCACATTCTCTCTGTGG
GAACATGATCGCATGGCCGACCTAGCGGTCGACGGCGTCTCCCTTCTTCTCAATGATGTAGAGCGCTGGCGCGGC
TATCTCGACGAAGACAAGCGCGGGGAATTCACCTGGCATCGCCATGGCCATGATGGCCTGGAGCTACAAACAAAT
CCTCGTCTAGTCAATCGTGATTTGGACACTAACATTGAACCTAGATCGGTTCTTTTGGCTGATAGTGACCCTGAT
GATGAACCAGAAGACCTATTTTTCCGATTCGCGTTTTTGAGAGGGTCCGAGGCTGGATCCTACAGTCCGACAGGA
GTCTGGCTGAGCGATGGCGCGTGGTGGCCCCCTGCGCCTCCCAAGAAATAG
Transcript >Pro_DTO377G3_2|g6383.t1
ATGTTTGGAGAGGGCCGAGAGCAAGCCGCCAGGCTATATGTTCCTCCGCTGCTTGAGGATGACGAGCGTCTGAAC
GATCCCGAAGCTTCCGAAGACCTGCCGCCGCCGGACGTTGAGGCAGGCAGCACTCTTCCCGTCTGGTTGCAAGAA
TCATCCAAGTCGTTTCGCTGGGGATGGGTGCCGCTACCGCTCCGAAAGGTCGGTCGCGCCACCGTCAATTGGGTC
AAGGGTCCCGATCCCCCGCATATGCTTCTGTTGAAACCTCTGTTTCCGCGATTCCAGGAACTTCCAGTCCAATAC
CTTGACCATTTCTTCCCAAAGCGCAAATTTAAGACTTTACTCTTATTGCTGCTCTATTTATCTTGGTTCTTGCCT
TGGTTTTTGGTTTTATTACACTCGCGTTCTTCCGGTTATATCGAAGGTTACGGTCGGCCTCAGACGCTGTCCTGC
TCGACGAACTTCTGGGAGGTCGACAATGGATGTGGTATTAACGGAAACGACTGCCGTCCATTTTCTTCATCAACT
ATTCCCTTCCGGTGTCCTGCGAACTGCCGTGATACCAAATTACTGGAGCCTTACGTTGTGGGAAATAATACGTAC
AACTACCAAGGCCTAGTCATTGGAGGGCCTGGGCCGGATGGCTCCGACCCGGCACTTTACCGTGCGGATAGCTTT
ATCTGCCAGGCAGCAATCCATGTCGGTGCAATCTCCAACGATGGCGGATGCGGTGTCGTCAAGCTTGAAGGCGCA
GCGCACTCTTTCCCATCAGTCAAGCAACACGGTATTCTCTCTGCCGGGTTCCCATCGACATTCCCGAAGGCTTTC
AGCTTTCTCCAGCTATCCTCGCCACAAGCTAGCTGCCCCTCCGATCCACGCTGGACGCTTCTTGGAATCACTGCT
GCAGCAGTTGGCATCCTGTGGCTCTTCTGTACTTCACCGCCTGTGCTGTTTTTCAGTACATTCTTCATGGTGTTC
TGCCATACGGGACTTGTTGGAGATCCGCCCTCGTATCCTTTCTTGGCCGACCTTGTCTCCAGTCTTCTGTCACGA
CTGCTGCCAGCGTCGTTTGTTGTCTACGTACTTTACAAGTTCTGTGCTGCGCCGCTGTTGCAGCCGATATCCTCG
CCTATCTACCAGTTGTCAAAGTTGTTCCTTTTCCTACCTCCACTGTTCACTGGAGCCCTGAACAACTATACCTTT
GCGCGATTGATTCCATTGCAGCGTCTAACTCCAATGGACATTCAGAAACAACCGGGGGCAAAGTTGGCATTGGCT
CTCGTCATCCCAATTGTGATTTCGATTATCCTAAGCCAGGCGTGGCAAATTCGCCAGGGAGGTCTGCTCCCACGG
TATTTGAAGATATACGGTACCATGGGTGTCATCATCTTGATTTTGCTTCCCCTTCCTGGGCTTCGCCTTCGAATT
CACCATTATATCCTCGCCATTCTCCTCATGCCCGGCACCGCCTTTCCCACCCGGCCCTCGCTTGTCTACCAGGGT
CTGCTGCTGGGTCTTTTCATCAATGGAGTTGCGCGGTGGGGCTTCGCCTCAATTATCGAGACTCCGGCAGCCCTA
GGAGAGCAAGCGCCACTTGGAGATGGAATCCATGGCTGGTGGGGTGCTACCTATCCTAATATCACGGCCACATCC
GTGAATGTCTCCCTTCCAGAGTTGGATTCGAATCACACTTATCGCGGCAATGGTAACATCACATTCTCTCTGTGG
GAACATGATCGCATGGCCGACCTAGCGGTCGACGGCGTCTCCCTTCTTCTCAATGATGTAGAGCGCTGGCGCGGC
TATCTCGACGAAGACAAGCGCGGGGAATTCACCTGGCATCGCCATGGCCATGATGGCCTGGAGCTACAAACAAAT
CCTCGTCTAGTCAATCGTGATTTGGACACTAACATTGAACCTAGATCGGTTCTTTTGGCTGATAGTGACCCTGAT
GATGAACCAGAAGACCTATTTTTCCGATTCGCGTTTTTGAGAGGGTCCGAGGCTGGATCCTACAGTCCGACAGGA
GTCTGGCTGAGCGATGGCGCGTGGTGGCCCCCTGCGCCTCCCAAGAAATAG
Gene >Pro_DTO377G3_2|g6383.t1
ATGTTTGGAGAGGGCCGAGAGCAAGCCGCCAGGCTATATGTTCCTCCGCTGCTTGAGGATGACGAGCGTCTGAAC
GATCCCGAAGCTTCCGAAGACCTGCCGCCGCCGGACGTTGAGGCAGGCAGCACTCTTCCCGTCTGGTTGCAAGAA
TCATCCAAGTCGTTTCGCTGGGGATGGGTGCCGCTACCGCTCCGAAAGGTCGGTCGCGCCACCGTCAATTGGGTC
AAGGGTCCCGATCCCCCGCATATGCTTCTGTTGAAACCTCTGTTTCCGCGATTCCAGGAACTTCCAGTCCAATAC
CTTGACCATTTCTTCCCAAAGCGCAAATTTAAGACTTTACTCTTATTGCTGCTCTATTTATCTTGGTTCTTGCCT
TGGTTTTTGGTTTTATTACACTCGCGTTCTTCCGGTTATATCGAAGGTTACGGTCGGCCTCAGACGCTGTCCTGC
TCGACGAACTTCTGGTACGTGCGGAAATGGAAGCGCCATCTAGGTATAAAATCCGCTAACATGTATTTGATTGCT
TAGGGAGGTCGACAATGGATGTGGTATTAACGGAAACGACTGCCGTCCATTTTCTTCATCAACTATTCCCTTCCG
GTGTCCTGCGAACTGCCGTGATACCAAATTACTGGAGCCTTACGTTGTGGGAAATAATACGTACAACTACCAAGG
CCTAGTCATTGGAGGGCCTGGGCCGGATGGCTCCGACCCGGCACTTTACCGTGCGGATAGCTTTATCTGCCAGGC
AGCAATCCATGTCGGTGCAATCTCCAACGATGGCGGATGCGGTGTCGTCAAGCTTGAAGGCGCAGCGCACTCTTT
CCCATCAGTCAAGCAACACGGTATTCTCTCTGCCGGGTTCCCATCGACATTCCCGAAGGCTTTCAGCTTTCTCCA
GCTATCCTCGCCACAAGCTAGCTGCCCCTCCGATCCACGCTGGACGCTTCTTGGAATCACTGCTGCAGCAGTTGG
CATCCTGTGGCTCTTCTGTACTTCACCGCCTGTGCTGTTTTTCAGTACATTCTTCATGGTGTTCTGCCATACGGG
ACTTGTTGGAGATCCGCCCTCGTATCCTTTCTTGGCCGACCTTGTCTCCAGTCTTCTGTCACGACTGCTGCCAGC
GTCGTTTGTTGTCTACGTACTTTACAAGTTCTGTGCTGCGCCGCTGTTGCAGCCGATATCCTCGCCTATCTACCA
GTTGTCAAAGTTGTTCCTTTTCCTACCTCCACTGTTCACTGGAGCCCTGAACAACTATACCTTTGCGCGATTGAT
TCCATTGCAGCGTCTAACTCCAATGGACATTCAGAAACAACCGGGGGCAAAGTTGGCATTGGCTCTCGTCATCCC
AATTGTGATTTCGATTATCCTAAGCCAGGCGTGGCAAATTCGCCAGGGAGGTCTGCTCCCACGGTATTTGAAGAT
ATACGGTACCATGGGTGTCATCATCTTGATTTTGCTTCCCCTTCCTGGGCTTCGCCTTCGAATTCACCATTATAT
CCTCGCCATTCTCCTCATGCCCGGCACCGCCTTTCCCACCCGGCCCTCGCTTGTCTACCAGGGTCTGCTGCTGGG
TCTTTTCATCAATGGAGTTGCGCGGTGGGGCTTCGCCTCAATTATCGAGACTCCGGCAGCCCTAGGAGAGCAAGC
GCCACTTGGAGATGGAATCCATGGCTGGTGGGGTGCTACCTATCCTAATATCACGGCCACATCCGTGAATGTCTC
CCTTCCAGAGTTGGATTCGAATCACACTTATCGCGGCAATGGTAACATCACATTCTCTCTGTGGGAACATGATCG
CATGGCCGACCTAGCGGTCGACGGCGTCTCCCTTCTTCTCAATGATGTAGAGCGCTGGCGCGGCTATCTCGACGA
AGACAAGCGCGGGGAATTCACCTGGCATCGCCATGGCCATGATGGCCTGGAGCTACAAACAAATCCTCGTCTAGT
CAATCGTGATTTGGACACTAACATTGAACCTAGATCGGTTCTTTTGGCTGATAGTGACCCTGATGATGAACCAGA
AGACCTATTTTTCCGATTCGCGTTTTTGAGAGGGTCCGAGGCTGGATCCTACAGTCCGACAGGAGTCTGGCTGAG
CGATGGCGCGTGGTGGCCCCCTGCGCCTCCCAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail