Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6379.t1
Gene name
Locationscaffold_17:27313..28543
Strand-
Gene length (bp)1230
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00956 NAP Nucleosome assembly protein (NAP) 1.4E-29 65 316

GO

GO Term Description Terminal node
GO:0006334 nucleosome assembly Yes
GO:0005634 nucleus Yes
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0022607 cellular component assembly No
GO:0044464 cell part No
GO:0043227 membrane-bounded organelle No
GO:0016043 cellular component organization No
GO:0006325 chromatin organization No
GO:0034728 nucleosome organization No
GO:0043933 protein-containing complex subunit organization No
GO:0071840 cellular component organization or biogenesis No
GO:0065003 protein-containing complex assembly No
GO:0043226 organelle No
GO:0034622 cellular protein-containing complex assembly No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0071824 protein-DNA complex subunit organization No
GO:0008150 biological_process No
GO:0065004 protein-DNA complex assembly No
GO:0044424 intracellular part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6379.t1
MSNDQSLLDRVEMPSIPEAAMKKIAVLEEQFARAEVEQLRHSVKLMTPLIQKRSEIINIPDVQAEFWMRVFASAP
PEIDEYILATDAQVLGECLKNMNVERFELDAQGNGEPRSLRFTFEFKTGDENPFFTNEKLVKEFYWRQEVSKNAA
GKTRTWEGLVSEPVRINWKKDQDLTKGMLDAACDLAEAEKKKGGDRRKLPEFAALVKKVEEAEAEANEDDEDDEE
PSPVGMSFFGFFGYRGRDVSAAQSKEAAKEIEARWAKIQNGEDIEEAGDSDSEDEEDDTEGVEEIDIFPDGDDLA
VAIAEDLWPDALSYYVQSFQIGEELEDMDLDMEELDGDDSDEDSELRPRKKARN*
Coding >Pro_DTO377G3_2|g6379.t1
ATGTCTAACGATCAGTCCCTCCTTGACCGTGTCGAGATGCCTAGCATCCCTGAGGCTGCTATGAAGAAGATTGCT
GTTCTGGAAGAGCAGTTCGCCCGTGCTGAGGTTGAGCAGTTGCGCCACTCCGTCAAGCTCATGACCCCCCTGATC
CAGAAGCGCAGCGAGATCATCAACATCCCCGATGTCCAGGCTGAGTTCTGGATGCGCGTCTTTGCTAGCGCTCCC
CCCGAGATCGACGAGTACATCCTGGCCACCGATGCCCAAGTGCTCGGTGAGTGCCTCAAGAACATGAACGTCGAG
CGATTCGAGCTCGACGCCCAAGGCAACGGCGAGCCCCGCAGCTTGCGCTTCACATTTGAGTTCAAGACCGGCGAC
GAGAACCCCTTCTTCACCAACGAGAAGCTCGTCAAGGAGTTCTACTGGCGCCAGGAGGTCTCCAAGAACGCCGCT
GGCAAGACCCGCACCTGGGAGGGTCTGGTCTCCGAGCCCGTCCGTATCAACTGGAAGAAGGATCAGGATTTGACC
AAGGGCATGCTCGATGCCGCTTGCGACCTTGCCGAGGCTGAGAAGAAGAAGGGCGGTGACCGCAGAAAGTTGCCC
GAGTTCGCTGCTCTCGTTAAGAAGGTCGAGGAGGCTGAGGCCGAGGCCAACGAGGATGACGAGGATGACGAGGAG
CCCAGCCCCGTTGGCATGAGCTTCTTCGGATTCTTCGGATACCGCGGCCGTGATGTCTCCGCCGCTCAGTCCAAG
GAGGCTGCCAAGGAGATCGAGGCTCGCTGGGCCAAGATCCAGAACGGCGAGGATATCGAGGAGGCCGGTGACTCC
GACTCCGAGGATGAGGAAGATGACACCGAGGGAGTTGAGGAAATCGATATCTTCCCCGATGGAGATGACCTTGCT
GTTGCCATTGCCGAGGACCTCTGGCCCGATGCGCTCAGCTACTACGTTCAATCCTTCCAAATCGGCGAAGAGCTC
GAAGATATGGACCTCGATATGGAGGAACTGGACGGAGACGACTCCGATGAAGACAGTGAGTTGCGTCCGCGCAAG
AAGGCTCGAAACTAA
Transcript >Pro_DTO377G3_2|g6379.t1
ATGTCTAACGATCAGTCCCTCCTTGACCGTGTCGAGATGCCTAGCATCCCTGAGGCTGCTATGAAGAAGATTGCT
GTTCTGGAAGAGCAGTTCGCCCGTGCTGAGGTTGAGCAGTTGCGCCACTCCGTCAAGCTCATGACCCCCCTGATC
CAGAAGCGCAGCGAGATCATCAACATCCCCGATGTCCAGGCTGAGTTCTGGATGCGCGTCTTTGCTAGCGCTCCC
CCCGAGATCGACGAGTACATCCTGGCCACCGATGCCCAAGTGCTCGGTGAGTGCCTCAAGAACATGAACGTCGAG
CGATTCGAGCTCGACGCCCAAGGCAACGGCGAGCCCCGCAGCTTGCGCTTCACATTTGAGTTCAAGACCGGCGAC
GAGAACCCCTTCTTCACCAACGAGAAGCTCGTCAAGGAGTTCTACTGGCGCCAGGAGGTCTCCAAGAACGCCGCT
GGCAAGACCCGCACCTGGGAGGGTCTGGTCTCCGAGCCCGTCCGTATCAACTGGAAGAAGGATCAGGATTTGACC
AAGGGCATGCTCGATGCCGCTTGCGACCTTGCCGAGGCTGAGAAGAAGAAGGGCGGTGACCGCAGAAAGTTGCCC
GAGTTCGCTGCTCTCGTTAAGAAGGTCGAGGAGGCTGAGGCCGAGGCCAACGAGGATGACGAGGATGACGAGGAG
CCCAGCCCCGTTGGCATGAGCTTCTTCGGATTCTTCGGATACCGCGGCCGTGATGTCTCCGCCGCTCAGTCCAAG
GAGGCTGCCAAGGAGATCGAGGCTCGCTGGGCCAAGATCCAGAACGGCGAGGATATCGAGGAGGCCGGTGACTCC
GACTCCGAGGATGAGGAAGATGACACCGAGGGAGTTGAGGAAATCGATATCTTCCCCGATGGAGATGACCTTGCT
GTTGCCATTGCCGAGGACCTCTGGCCCGATGCGCTCAGCTACTACGTTCAATCCTTCCAAATCGGCGAAGAGCTC
GAAGATATGGACCTCGATATGGAGGAACTGGACGGAGACGACTCCGATGAAGACAGTGAGTTGCGTCCGCGCAAG
AAGGCTCGAAACTAA
Gene >Pro_DTO377G3_2|g6379.t1
ATGTCTAACGATCAGTCCCTCCTTGACCGTGTCGAGATGCCTAGCATCCCTGAGGCTGCTATGAAGAAGATTGCT
GTTCTGGAAGAGCAGTTCGCCCGTGCTGAGGTTGAGCAGTGTATGTTTCTGTTGATTTTCTATTTTGTTATGGAG
TGAACAGCTCGCAGAGGCTACTCTACCATGCATTCAGAAGCGCACCTATCGATAACCCAATTGCTAACATACACA
CTCTAGTGCGCCACTCCGTCAAGCTCATGACCCCCCTGATCCAGAAGCGCAGCGAGATCATCAACATCCCCGATG
TCCAGGCTGAGTTCTGGATGCGCGTCTTTGCTAGCGCTCCCCCCGAGATCGACGAGTACATCCTGGCCACCGATG
CCCAAGTGCTCGGTGAGTGCCTCAAGAACATGAACGTCGAGCGATTCGAGCTCGACGCCCAAGGCAACGGCGAGC
CCCGCAGCTTGCGCTTCACATTTGAGTTCAAGACCGGCGACGAGAACCCCTTCTTCACCAACGAGAAGCTCGTCA
AGGAGTTCTACTGGCGCCAGGAGGTCTCCAAGAACGCCGCTGGCAAGACCCGCACCTGGGAGGGTCTGGTCTCCG
AGCCCGTCCGTATCAACTGGAAGAAGGATCAGGATTTGACCAAGGGCATGCTCGATGCCGCTTGCGACCTTGCCG
AGGCTGAGAAGAAGAAGGGCGGTGACCGCAGAAAGTTGCCCGAGTTCGCTGCTCTCGTTAAGAAGGTCGAGGAGG
CTGAGGCCGAGGCCAACGAGGATGACGAGGATGACGAGGAGCCCAGCCCCGTTGGCATGAGCTTCTTCGGATTCT
TCGGATACCGCGGCCGTGATGTCTCCGCCGCTCAGTCCAAGGAGGCTGCCAAGGAGATCGAGGCTCGCTGGGCCA
AGATCCAGAACGGCGAGGATATCGAGGAGGCCGGTGACTCCGACTCCGAGGATGAGGAAGATGACACCGAGGGAG
TTGAGGAAATCGATATCTTCCCCGATGGAGATGACCTTGCTGTTGCCATTGCCGAGGACCTCTGGCCCGATGCGC
TCAGCTACTACGGTATGTAGATCCCGAACGAGTCAGATGTTCCCCTGCTGACTTTGACCAGTTCAATCCTTCCAA
ATCGGCGAAGAGCTCGAAGATATGGACCTCGATATGGAGGAACTGGACGGAGACGACTCCGATGAAGACAGTGAG
TTGCGTCCGCGCAAGAAGGCTCGAAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail