Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6373.t1
Gene name
Locationscaffold_17:14033..17270
Strand-
Gene length (bp)3237
Transcript length (bp)2967
Coding sequence length (bp)2967
Protein length (aa) 989

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03124 EXS EXS family 1.8E-97 521 844
PF03105 SPX SPX domain 1.6E-84 1 428

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 517 539 22
2 568 590 22
3 595 617 22
4 713 735 22
5 745 767 22
6 788 810 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6373.t1
MKFAKELEQELVPEWRAKYLDYKTGKKKVKAITRALQKANRSPRVPSYRPPTSSPQSRGAVQSALTPSNTDKHLD
AGEYNGPSTPRRSGAKPPSARSTPVPKTERQPLRTPGSRFSENVGSYGSILATPPQQHHTAGSDVASFELPDPAL
DPGEDYPPHEDTADRLGNLRTPSPVMDRRGMLNGSPSRPLSEPLPAKRPQLDPRTSYSSGDALTKVASGNRTSQL
LRRVFTAEVDPSATSELDKRRDEFFEFLDSELHKIDSFYVTKEQEATEKLRVLRQQLHIMRDQRIQEVLASKRIK
SDDSETHQRPNGFAKITNARIKGSLVGKNRFGKNSEALAEMATPGMQPQDREFIANRRDFMRRQDPQSQEVPYRS
AKRKLKHALQEFYRGVELLKGYAYLNRTAFRKINKKYDKAVHARPPLRYMSEKVNKASFVQSEVIESLMTAVEDL
YARYFEGGNRKIAVSKLRHTINKSGDYSPNTFRSGLLLMGGTLFAIKALVDSKSNLRSPNVAEQVRTSYLLQIYG
GYFLIVFHFLLFCLDCMIWTKSKINHAFVFEYDTRNTLEWRQLLEIPSFFLFLMGLFMWLNFSWYNHMYVYWPVV
LIGLTVIIIFLPARVLYHRSRKWFAFSNWRLLLAGIYPVEFRDFFLGDMYCSQTYAMGNIELFFCLYASYWDYPP
KCNSSHSRLLGFFQCLPSVWRAFQCIRRYLDTKNAFPHLLNLGKYLFGVLYYATLSMYRIDLQTRFQASFITFAL
LNAVYTSVWDLIMDWSLGNPYAKNPMLREVLAFRRVWVYYAAMVLDVVIRFNWIFYAIFIKNIQQSALLSFMVAF
SEVCRRGIWSIFRVENEHCTNVLLFRASRDVPLPYDVPSRAAAPLDGSAEDVQLEEQQHASTPFMAPGDVENGTP
SGSSLRARNRRPSVGISRVGSIVASAHAQDFERRRLPNYMSSASVGPDMADGGDDSTDEDDEADLSTDEDSESRP
DSERRDTMGRIIE*
Coding >Pro_DTO377G3_2|g6373.t1
ATGAAATTTGCCAAAGAGCTGGAACAGGAACTCGTTCCTGAATGGCGGGCAAAGTATCTCGACTACAAGACTGGC
AAGAAGAAAGTCAAGGCCATCACCCGGGCCCTACAGAAGGCAAATCGCAGTCCCCGCGTCCCGTCCTATCGACCG
CCCACTTCCAGCCCGCAAAGTCGCGGCGCAGTCCAATCTGCTCTCACACCCTCCAATACCGATAAGCATCTCGAT
GCAGGAGAATACAATGGCCCATCGACGCCACGACGAAGTGGTGCCAAGCCGCCATCAGCGCGCTCCACGCCGGTG
CCCAAAACTGAGCGACAACCGCTTCGCACGCCAGGATCGCGGTTCTCTGAGAACGTTGGTAGTTATGGAAGCATA
CTCGCAACGCCGCCACAACAGCACCATACCGCAGGCTCGGATGTAGCCTCATTTGAACTTCCGGACCCGGCACTT
GACCCGGGTGAAGACTATCCGCCACATGAGGATACTGCAGATAGACTTGGGAATCTCCGGACACCTTCGCCGGTC
ATGGATCGACGTGGCATGCTGAACGGCTCACCCTCTCGCCCTTTATCAGAACCATTGCCGGCCAAGAGGCCCCAA
TTGGATCCACGGACGAGCTATTCGAGTGGTGACGCCTTGACGAAGGTGGCCTCGGGCAACCGGACATCACAGCTG
CTGCGGCGCGTGTTTACGGCAGAGGTAGACCCTAGCGCTACATCAGAGCTTGATAAACGTCGGGACGAATTCTTC
GAGTTCTTGGATAGCGAATTGCACAAAATCGATTCGTTTTATGTGACGAAAGAACAAGAGGCCACCGAGAAACTG
CGGGTCCTTCGCCAGCAGTTACATATTATGCGAGACCAGCGAATCCAAGAGGTCCTGGCTTCTAAGAGAATCAAA
TCCGATGACTCGGAGACACATCAACGACCAAATGGGTTCGCGAAAATCACGAATGCTCGAATCAAGGGTTCGTTG
GTGGGAAAGAACCGTTTCGGCAAGAACTCGGAAGCACTGGCGGAGATGGCGACTCCCGGCATGCAACCCCAAGAT
CGGGAGTTCATCGCCAACCGGAGGGACTTCATGCGGCGGCAGGATCCGCAAAGTCAAGAAGTGCCCTATCGCTCC
GCTAAGCGTAAGCTCAAGCATGCGTTGCAGGAGTTCTACCGCGGAGTGGAGCTCCTCAAGGGATATGCTTATTTG
AATCGAACGGCTTTCCGGAAGATTAACAAGAAATACGACAAAGCGGTCCACGCCCGTCCACCGCTCCGGTACATG
TCTGAAAAGGTCAACAAAGCGTCCTTCGTACAGAGTGAGGTGATTGAGAGTTTGATGACAGCGGTCGAAGACTTG
TATGCCCGTTACTTTGAGGGCGGTAATCGCAAAATCGCCGTCTCCAAACTCCGTCACACAATCAACAAATCTGGT
GATTACTCACCGAATACTTTCCGCTCCGGTCTATTGTTGATGGGTGGAACTCTGTTTGCCATCAAGGCCTTGGTT
GATTCTAAGTCAAATCTCCGCTCGCCTAACGTCGCTGAACAAGTTCGGACCAGTTATCTCCTCCAGATATATGGA
GGGTATTTCCTGATCGTCTTCCATTTCTTGCTCTTCTGCTTGGATTGTATGATTTGGACAAAGTCGAAGATCAAT
CATGCATTTGTCTTCGAATACGATACCAGAAACACCTTAGAGTGGCGTCAGTTGCTAGAGATCCCTTCTTTCTTC
CTTTTCTTGATGGGCCTATTCATGTGGCTCAACTTCTCATGGTACAACCACATGTATGTCTATTGGCCTGTCGTC
CTTATTGGCTTGACTGTGATCATTATTTTCTTGCCGGCCCGTGTTCTTTACCACAGGAGTCGCAAATGGTTCGCA
TTTTCCAATTGGCGCCTTTTGCTTGCCGGAATCTACCCAGTCGAGTTCCGTGATTTCTTCCTCGGTGACATGTAC
TGTTCTCAGACATATGCTATGGGGAACATCGAGCTCTTCTTCTGTCTATATGCCTCGTACTGGGACTACCCTCCC
AAGTGCAACTCCTCCCACTCTCGGCTCCTGGGCTTTTTCCAATGCCTCCCCTCTGTCTGGCGAGCTTTCCAATGT
ATTCGCCGATATCTGGACACGAAGAACGCGTTCCCCCATCTCCTGAACTTGGGCAAGTATTTATTCGGTGTCCTC
TACTATGCCACTCTCAGCATGTACCGCATCGACCTTCAAACGAGGTTCCAAGCCTCGTTTATCACCTTCGCCCTC
CTAAACGCCGTCTACACCTCAGTGTGGGATCTAATCATGGATTGGAGTTTGGGTAACCCATACGCAAAGAACCCA
ATGCTCCGTGAAGTCCTCGCCTTCCGTCGCGTATGGGTATACTATGCCGCAATGGTGCTCGATGTGGTGATCCGT
TTCAACTGGATCTTCTACGCAATATTCATCAAAAATATACAGCAGTCCGCCCTGCTTAGCTTTATGGTCGCCTTC
TCGGAGGTCTGTCGCCGTGGCATTTGGTCCATCTTCCGTGTCGAAAACGAACACTGCACCAATGTCCTCCTCTTC
CGCGCCTCCCGTGATGTCCCTCTCCCCTACGATGTCCCCTCACGAGCCGCAGCACCCCTCGACGGCTCAGCAGAA
GATGTCCAACTCGAAGAACAGCAGCACGCCTCAACACCTTTCATGGCGCCCGGCGATGTCGAAAACGGCACCCCG
TCCGGGTCCAGCTTGCGGGCCCGCAACCGCCGCCCCTCGGTTGGCATCAGCCGGGTCGGCTCGATTGTAGCCTCA
GCCCACGCGCAGGATTTCGAGCGAAGACGTCTACCAAATTACATGTCCAGCGCAAGTGTAGGACCGGATATGGCA
GACGGCGGAGACGATAGCACGGACGAAGACGACGAGGCGGATCTGAGCACAGACGAGGATTCGGAATCGAGACCG
GATTCAGAGCGCAGAGACACGATGGGTCGGATTATTGAATAG
Transcript >Pro_DTO377G3_2|g6373.t1
ATGAAATTTGCCAAAGAGCTGGAACAGGAACTCGTTCCTGAATGGCGGGCAAAGTATCTCGACTACAAGACTGGC
AAGAAGAAAGTCAAGGCCATCACCCGGGCCCTACAGAAGGCAAATCGCAGTCCCCGCGTCCCGTCCTATCGACCG
CCCACTTCCAGCCCGCAAAGTCGCGGCGCAGTCCAATCTGCTCTCACACCCTCCAATACCGATAAGCATCTCGAT
GCAGGAGAATACAATGGCCCATCGACGCCACGACGAAGTGGTGCCAAGCCGCCATCAGCGCGCTCCACGCCGGTG
CCCAAAACTGAGCGACAACCGCTTCGCACGCCAGGATCGCGGTTCTCTGAGAACGTTGGTAGTTATGGAAGCATA
CTCGCAACGCCGCCACAACAGCACCATACCGCAGGCTCGGATGTAGCCTCATTTGAACTTCCGGACCCGGCACTT
GACCCGGGTGAAGACTATCCGCCACATGAGGATACTGCAGATAGACTTGGGAATCTCCGGACACCTTCGCCGGTC
ATGGATCGACGTGGCATGCTGAACGGCTCACCCTCTCGCCCTTTATCAGAACCATTGCCGGCCAAGAGGCCCCAA
TTGGATCCACGGACGAGCTATTCGAGTGGTGACGCCTTGACGAAGGTGGCCTCGGGCAACCGGACATCACAGCTG
CTGCGGCGCGTGTTTACGGCAGAGGTAGACCCTAGCGCTACATCAGAGCTTGATAAACGTCGGGACGAATTCTTC
GAGTTCTTGGATAGCGAATTGCACAAAATCGATTCGTTTTATGTGACGAAAGAACAAGAGGCCACCGAGAAACTG
CGGGTCCTTCGCCAGCAGTTACATATTATGCGAGACCAGCGAATCCAAGAGGTCCTGGCTTCTAAGAGAATCAAA
TCCGATGACTCGGAGACACATCAACGACCAAATGGGTTCGCGAAAATCACGAATGCTCGAATCAAGGGTTCGTTG
GTGGGAAAGAACCGTTTCGGCAAGAACTCGGAAGCACTGGCGGAGATGGCGACTCCCGGCATGCAACCCCAAGAT
CGGGAGTTCATCGCCAACCGGAGGGACTTCATGCGGCGGCAGGATCCGCAAAGTCAAGAAGTGCCCTATCGCTCC
GCTAAGCGTAAGCTCAAGCATGCGTTGCAGGAGTTCTACCGCGGAGTGGAGCTCCTCAAGGGATATGCTTATTTG
AATCGAACGGCTTTCCGGAAGATTAACAAGAAATACGACAAAGCGGTCCACGCCCGTCCACCGCTCCGGTACATG
TCTGAAAAGGTCAACAAAGCGTCCTTCGTACAGAGTGAGGTGATTGAGAGTTTGATGACAGCGGTCGAAGACTTG
TATGCCCGTTACTTTGAGGGCGGTAATCGCAAAATCGCCGTCTCCAAACTCCGTCACACAATCAACAAATCTGGT
GATTACTCACCGAATACTTTCCGCTCCGGTCTATTGTTGATGGGTGGAACTCTGTTTGCCATCAAGGCCTTGGTT
GATTCTAAGTCAAATCTCCGCTCGCCTAACGTCGCTGAACAAGTTCGGACCAGTTATCTCCTCCAGATATATGGA
GGGTATTTCCTGATCGTCTTCCATTTCTTGCTCTTCTGCTTGGATTGTATGATTTGGACAAAGTCGAAGATCAAT
CATGCATTTGTCTTCGAATACGATACCAGAAACACCTTAGAGTGGCGTCAGTTGCTAGAGATCCCTTCTTTCTTC
CTTTTCTTGATGGGCCTATTCATGTGGCTCAACTTCTCATGGTACAACCACATGTATGTCTATTGGCCTGTCGTC
CTTATTGGCTTGACTGTGATCATTATTTTCTTGCCGGCCCGTGTTCTTTACCACAGGAGTCGCAAATGGTTCGCA
TTTTCCAATTGGCGCCTTTTGCTTGCCGGAATCTACCCAGTCGAGTTCCGTGATTTCTTCCTCGGTGACATGTAC
TGTTCTCAGACATATGCTATGGGGAACATCGAGCTCTTCTTCTGTCTATATGCCTCGTACTGGGACTACCCTCCC
AAGTGCAACTCCTCCCACTCTCGGCTCCTGGGCTTTTTCCAATGCCTCCCCTCTGTCTGGCGAGCTTTCCAATGT
ATTCGCCGATATCTGGACACGAAGAACGCGTTCCCCCATCTCCTGAACTTGGGCAAGTATTTATTCGGTGTCCTC
TACTATGCCACTCTCAGCATGTACCGCATCGACCTTCAAACGAGGTTCCAAGCCTCGTTTATCACCTTCGCCCTC
CTAAACGCCGTCTACACCTCAGTGTGGGATCTAATCATGGATTGGAGTTTGGGTAACCCATACGCAAAGAACCCA
ATGCTCCGTGAAGTCCTCGCCTTCCGTCGCGTATGGGTATACTATGCCGCAATGGTGCTCGATGTGGTGATCCGT
TTCAACTGGATCTTCTACGCAATATTCATCAAAAATATACAGCAGTCCGCCCTGCTTAGCTTTATGGTCGCCTTC
TCGGAGGTCTGTCGCCGTGGCATTTGGTCCATCTTCCGTGTCGAAAACGAACACTGCACCAATGTCCTCCTCTTC
CGCGCCTCCCGTGATGTCCCTCTCCCCTACGATGTCCCCTCACGAGCCGCAGCACCCCTCGACGGCTCAGCAGAA
GATGTCCAACTCGAAGAACAGCAGCACGCCTCAACACCTTTCATGGCGCCCGGCGATGTCGAAAACGGCACCCCG
TCCGGGTCCAGCTTGCGGGCCCGCAACCGCCGCCCCTCGGTTGGCATCAGCCGGGTCGGCTCGATTGTAGCCTCA
GCCCACGCGCAGGATTTCGAGCGAAGACGTCTACCAAATTACATGTCCAGCGCAAGTGTAGGACCGGATATGGCA
GACGGCGGAGACGATAGCACGGACGAAGACGACGAGGCGGATCTGAGCACAGACGAGGATTCGGAATCGAGACCG
GATTCAGAGCGCAGAGACACGATGGGTCGGATTATTGAATAG
Gene >Pro_DTO377G3_2|g6373.t1
ATGAAATTTGCCAAGTTTGTATTCCCCCGTGACAGTGTGCGACATTCCAGTGGCTGACCAAATCCGCAGAGAGCT
GGAACAGGAACTCGTTCCTGAATGGCGGGCAAAGTATCTCGACTACAAGGTTCGTCATCATTGCCACATTGTGTC
ACAGCTGTACTTACCTGAATGTACTGTCTAGACTGGCAAGAAGAAAGTCAAGGCCATCACCCGGGCCCTACAGAA
GGCAAATCGCAGTCCCCGCGTCCCGTCCTATCGACCGCCCACTTCCAGCCCGCAAAGTCGCGGCGCAGTCCAATC
TGCTCTCACACCCTCCAATACCGATAAGCATCTCGATGCAGGAGAATACAATGGCCCATCGACGCCACGACGAAG
TGGTGCCAAGCCGCCATCAGCGCGCTCCACGCCGGTGCCCAAAACTGAGCGACAACCGCTTCGCACGCCAGGATC
GCGGTTCTCTGAGAACGTTGGTAGTTATGGAAGCATACTCGCAACGCCGCCACAACAGCACCATACCGCAGGCTC
GGATGTAGCCTCATTTGAACTTCCGGACCCGGCACTTGACCCGGGTGAAGACTATCCGCCACATGAGGATACTGC
AGATAGACTTGGGAATCTCCGGACACCTTCGCCGGTCATGGATCGACGTGGCATGCTGAACGGCTCACCCTCTCG
CCCTTTATCAGAACCATTGCCGGCCAAGAGGCCCCAATTGGATCCACGGACGAGCTATTCGAGTGGTGACGCCTT
GACGAAGGTGGCCTCGGGCAACCGGACATCACAGCTGCTGCGGCGCGTGTTTACGGCAGAGGTAGACCCTAGCGC
TACATCAGAGCTTGATAAACGTCGGGACGAATTCTTCGAGTTCTTGGATAGCGAATTGCACAAAATCGATTCGTT
TTATGTGACGAAAGAACAAGAGGCCACCGAGAAACTGCGGGTCCTTCGCCAGCAGTTACATATTATGCGAGACCA
GCGAATCCAAGAGGTCCTGGCTTCTAAGAGAATCAAATCCGATGACTCGGAGACACATCAACGACCAAATGGGTT
CGCGAAAATCACGAATGCTCGAATCAAGGGTTCGTTGGTGGGAAAGAACCGTTTCGGCAAGAACTCGGAAGCACT
GGCGGAGATGGCGACTCCCGGCATGCAACCCCAAGATCGGGAGTTCATCGCCAACCGGAGGGACTTCATGCGGCG
GCAGGATCCGCAAAGTCAAGAAGTGCCCTATCGCTCCGCTAAGCGTAAGCTCAAGCATGCGTTGCAGGAGTTCTA
CCGCGGAGTGGAGCTCCTCAAGGGATATGCTTATTTGAATCGAACGGCTTTCCGGAAGATTAACAAGAAATACGA
CAAAGCGGTCCACGCCCGTCCACCGCTCCGGTACATGTCTGAAAAGGTCAACAAAGCGTCCTTCGTACAGAGTGA
GGTGATTGAGAGTTTGATGACAGCGGTCGAAGACTTGTATGCCCGTTACTTTGAGGGCGGTAATCGCAAAATCGC
CGTCTCCAAACTCCGTCACACAATCAACAAATCTGGTGATTACTCACCGAATACTTTCCGCTCCGGTCTATTGTT
GATGGGTGGAACTCTGTTTGCCATCAAGGCCTTGGTTGATTCTAAGTCAAATCTCCGCTCGCCTAACGTCGCTGA
ACAAGTTCGGACCAGTTATCTCCTCCAGGTTGGTTCTTCGCTCTTTCGTCTTTTGTGTGACTCCATTGACCAATC
GAGCAGATATATGGAGGGTATTTCCTGATCGTCTTCCATTTCTTGCTCTTCTGCTTGGATTGTATGATTTGGACA
AAGTCGAAGATCAATCATGCATTTGTCTTCGAATACGATACCAGAAACACCTTAGAGTGGCGTCAGTTGCTAGAG
GTATGTCTTATTTCGCGGTAATAGCTCTGATCATTCATCCTGACAAGTACAGATCCCTTCTTTCTTCCTTTTCTT
GATGGGCCTATTCATGTGGCTCAACTTCTCATGGTACAACCACATGTATGTCTATTGGCCTGTCGTCCTTATTGG
CTTGACTGTGATCATTATTTTCTTGCCGGCCCGTGTTCTTTACCACAGGAGTCGCAAATGGTTCGCATTTTCCAA
TGTGAGTTCATACAGCATCATATTACTGTCGATTAGCATATCTAACCTATCTAGTGGCGCCTTTTGCTTGCCGGA
ATCTACCCAGTCGAGTTCCGTGATTTCTTCCTCGGTGACATGTACTGTTCTCAGACATATGCTATGGGGAACATC
GAGCTCTTCTTCTGTCTATATGCCTCGTACTGGGACTACCCTCCCAAGTGCAACTCCTCCCACTCTCGGCTCCTG
GGCTTTTTCCAATGCCTCCCCTCTGTCTGGCGAGCTTTCCAATGTATTCGCCGATATCTGGACACGAAGAACGCG
TTCCCCCATCTCCTGAACTTGGGCAAGTATTTATTCGGTGTCCTCTACTATGCCACTCTCAGCATGTACCGCATC
GACCTTCAAACGAGGTTCCAAGCCTCGTTTATCACCTTCGCCCTCCTAAACGCCGTCTACACCTCAGTGTGGGAT
CTAATCATGGATTGGAGTTTGGGTAACCCATACGCAAAGAACCCAATGCTCCGTGAAGTCCTCGCCTTCCGTCGC
GTATGGGTATACTATGCCGCAATGGTGCTCGATGTGGTGATCCGTTTCAACTGGATCTTCTACGCAATATTCATC
AAAAATATACAGCAGTCCGCCCTGCTTAGCTTTATGGTCGCCTTCTCGGAGGTCTGTCGCCGTGGCATTTGGTCC
ATCTTCCGTGTCGAAAACGAACACTGCACCAATGTCCTCCTCTTCCGCGCCTCCCGTGATGTCCCTCTCCCCTAC
GATGTCCCCTCACGAGCCGCAGCACCCCTCGACGGCTCAGCAGAAGATGTCCAACTCGAAGAACAGCAGCACGCC
TCAACACCTTTCATGGCGCCCGGCGATGTCGAAAACGGCACCCCGTCCGGGTCCAGCTTGCGGGCCCGCAACCGC
CGCCCCTCGGTTGGCATCAGCCGGGTCGGCTCGATTGTAGCCTCAGCCCACGCGCAGGATTTCGAGCGAAGACGT
CTACCAAATTACATGTCCAGCGCAAGTGTAGGACCGGATATGGCAGACGGCGGAGACGATAGCACGGACGAAGAC
GACGAGGCGGATCTGAGCACAGACGAGGATTCGGAATCGAGACCGGATTCAGAGCGCAGAGACACGATGGGTCGG
ATTATTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail