Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6372.t1
Gene name
Locationscaffold_17:9929..11588
Strand-
Gene length (bp)1659
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.4E-40 47 442

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 77 99 22
3 125 147 22
4 157 176 19
5 183 205 22
6 234 256 22
7 276 298 22
8 313 335 22
9 348 370 22
10 380 402 22
11 423 445 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6372.t1
MMDIKNEKDLEGLDPSQSREIQNSHINNHDDVFGEITESGPNYRNVGWAGTVILMMKSQIGLGVLSIPSTFDTLG
LVPGVICLIVVAVITTWSDYMVGVFKLNHRSVYGIDDAGYLMFGVIGREVFGFVFCLYWIFVAGSGMLGLSIALN
SVSSHATCTAVYVAVAAVAGIIFASIRTLGKISWLAWIGLTCILAAIFIVTIAVGVQDRPASAPQEGIWVSDYKI
VASPKFSEAISAVSSIIFAYAGTPAFFSIVSEMRDPKYYTRSLIICQSSVTAVYVTIGVVVYYYCGSYVASPALG
SAGDTMKKVSYGFAIPGLLVTVMLFVHLPAKFVFVRALRGSKHLTSNSMVHWGSWIGCTAAVGLISYVIASAIPV
FDSLVSLIGALLGTFMCFQPMGCMWLYDNWGKGKVDRSPRWMFMVSWSVFVIVIGSFMMVAGTYGSVVSIMDSYK
ANGGSAAWSCADNSNSS*
Coding >Pro_DTO377G3_2|g6372.t1
ATGATGGATATCAAAAACGAAAAAGACCTTGAAGGTCTTGATCCATCTCAGAGCCGTGAAATCCAGAATAGTCAT
ATCAACAACCACGATGATGTGTTTGGAGAGATCACCGAATCCGGACCCAACTACCGAAATGTAGGATGGGCAGGA
ACGGTGATCCTCATGATGAAGAGCCAGATCGGCCTCGGTGTCCTCTCCATCCCAAGCACCTTTGATACATTAGGC
CTCGTCCCAGGCGTTATCTGCCTGATCGTCGTTGCTGTTATTACAACGTGGTCCGACTACATGGTCGGCGTGTTT
AAGCTCAACCATCGCTCAGTCTACGGTATCGACGATGCAGGTTACTTGATGTTCGGTGTGATCGGTCGTGAGGTT
TTCGGCTTTGTGTTCTGCCTATACTGGATTTTCGTCGCCGGTTCAGGAATGCTCGGTCTGTCAATCGCTCTCAAC
TCCGTCTCGAGTCATGCCACATGCACGGCTGTCTATGTTGCTGTTGCAGCCGTCGCAGGAATTATCTTCGCCAGT
ATCCGAACTCTCGGAAAAATCAGTTGGTTAGCGTGGATTGGACTGACTTGCATATTGGCCGCAATCTTCATCGTC
ACCATCGCTGTCGGCGTTCAGGACCGCCCGGCCTCAGCCCCACAAGAGGGGATCTGGGTATCTGACTACAAGATC
GTTGCCAGTCCCAAATTCAGTGAAGCCATCAGTGCCGTGAGCTCGATTATCTTCGCCTACGCTGGCACACCGGCA
TTCTTCTCTATTGTATCGGAAATGCGCGACCCCAAATACTATACTCGCTCGTTGATCATCTGCCAAAGCAGCGTG
ACGGCTGTCTACGTTACCATCGGCGTTGTAGTCTACTACTACTGCGGCTCTTATGTTGCCTCGCCTGCTCTTGGC
TCCGCCGGCGATACGATGAAGAAGGTCAGCTATGGCTTTGCCATTCCAGGTCTTCTGGTTACTGTGATGCTGTTC
GTTCATTTGCCCGCGAAATTCGTCTTCGTCCGCGCCCTCAGAGGCTCCAAACACCTCACCTCAAACAGCATGGTG
CACTGGGGCTCGTGGATCGGCTGCACCGCAGCAGTCGGTCTTATTTCCTACGTCATCGCAAGTGCCATTCCCGTC
TTTGACAGTCTCGTCTCGCTTATCGGTGCTTTGCTCGGCACATTCATGTGTTTCCAACCCATGGGCTGCATGTGG
CTGTACGATAATTGGGGTAAGGGGAAGGTCGACCGATCCCCGAGGTGGATGTTCATGGTTTCCTGGAGTGTCTTT
GTTATCGTCATCGGCAGTTTCATGATGGTCGCTGGTACATATGGGTCTGTCGTCAGCATCATGGACAGCTACAAG
GCGAACGGTGGTTCAGCTGCGTGGTCCTGTGCGGATAACTCAAATTCTTCATAG
Transcript >Pro_DTO377G3_2|g6372.t1
ATGATGGATATCAAAAACGAAAAAGACCTTGAAGGTCTTGATCCATCTCAGAGCCGTGAAATCCAGAATAGTCAT
ATCAACAACCACGATGATGTGTTTGGAGAGATCACCGAATCCGGACCCAACTACCGAAATGTAGGATGGGCAGGA
ACGGTGATCCTCATGATGAAGAGCCAGATCGGCCTCGGTGTCCTCTCCATCCCAAGCACCTTTGATACATTAGGC
CTCGTCCCAGGCGTTATCTGCCTGATCGTCGTTGCTGTTATTACAACGTGGTCCGACTACATGGTCGGCGTGTTT
AAGCTCAACCATCGCTCAGTCTACGGTATCGACGATGCAGGTTACTTGATGTTCGGTGTGATCGGTCGTGAGGTT
TTCGGCTTTGTGTTCTGCCTATACTGGATTTTCGTCGCCGGTTCAGGAATGCTCGGTCTGTCAATCGCTCTCAAC
TCCGTCTCGAGTCATGCCACATGCACGGCTGTCTATGTTGCTGTTGCAGCCGTCGCAGGAATTATCTTCGCCAGT
ATCCGAACTCTCGGAAAAATCAGTTGGTTAGCGTGGATTGGACTGACTTGCATATTGGCCGCAATCTTCATCGTC
ACCATCGCTGTCGGCGTTCAGGACCGCCCGGCCTCAGCCCCACAAGAGGGGATCTGGGTATCTGACTACAAGATC
GTTGCCAGTCCCAAATTCAGTGAAGCCATCAGTGCCGTGAGCTCGATTATCTTCGCCTACGCTGGCACACCGGCA
TTCTTCTCTATTGTATCGGAAATGCGCGACCCCAAATACTATACTCGCTCGTTGATCATCTGCCAAAGCAGCGTG
ACGGCTGTCTACGTTACCATCGGCGTTGTAGTCTACTACTACTGCGGCTCTTATGTTGCCTCGCCTGCTCTTGGC
TCCGCCGGCGATACGATGAAGAAGGTCAGCTATGGCTTTGCCATTCCAGGTCTTCTGGTTACTGTGATGCTGTTC
GTTCATTTGCCCGCGAAATTCGTCTTCGTCCGCGCCCTCAGAGGCTCCAAACACCTCACCTCAAACAGCATGGTG
CACTGGGGCTCGTGGATCGGCTGCACCGCAGCAGTCGGTCTTATTTCCTACGTCATCGCAAGTGCCATTCCCGTC
TTTGACAGTCTCGTCTCGCTTATCGGTGCTTTGCTCGGCACATTCATGTGTTTCCAACCCATGGGCTGCATGTGG
CTGTACGATAATTGGGGTAAGGGGAAGGTCGACCGATCCCCGAGGTGGATGTTCATGGTTTCCTGGAGTGTCTTT
GTTATCGTCATCGGCAGTTTCATGATGGTCGCTGGTACATATGGGTCTGTCGTCAGCATCATGGACAGCTACAAG
GCGAACGGTGGTTCAGCTGCGTGGTCCTGTGCGGATAACTCAAATTCTTCATAG
Gene >Pro_DTO377G3_2|g6372.t1
ATGATGGATATCAAAAACGAAAAAGACCTTGAAGGTCTTGATCCATCTCAGAGCCGTGAAATCCAGAATAGTCAT
ATCAACAACCACGATGATGTGTTTGGAGAGATCACCGAATCCGGACCCAACTACCGAAATGTATGTTCCTTCTTT
TCCTCTTTTCTTCCTTTTCTTTTCTATGGAATGTCCAATTGGGTCAAACTAACGCCTCTTTAGGTAGGATGGGCA
GGAACGGTGATCCTCATGATGAAGAGCCAGATCGGCCTCGGTGTCCTCTCCATCCCAAGCACCTTTGATACATTA
GGCCTCGTCCCAGGCGTTATCTGCCTGATCGTCGTTGCTGTTATTACAACGTGGTCCGACTACATGGTCGGCGTG
TTTAAGCTCAACCATCGCTCAGTCTACGGTATCGACGATGCAGGTTACTTGATGTTCGGTGTGATCGGTCGTGAG
GTTTTCGGCTTTGTGTTCTGCCTATGTAGGTCTATGCAATGACCACGATTATAGATTCGCTTCTAACTTGCCTCT
CTAGACTGGATTTTCGTCGCCGGTTCAGGAATGCTCGGTCTGTCAATCGCTCTCAACTCCGTCTCGAGTCATGCC
ACATGCACGGCTGTCTATGTTGCTGTTGCAGCCGTCGCAGGAATTATCTTCGCCAGTATCCGAACTCTCGGAAAA
ATCAGTTGGTTAGCGTGGATTGGACTGACTTGCATATTGGCCGCAAGTAAGGTTTCCCTAGATGTCACGGGATAT
AACATAGCCCTAACCGATTCGTACTATAGTCTTCATCGTCACCATCGCTGTCGGCGTTCAGGACCGCCCGGCCTC
AGCCCCACAAGAGGGGATCTGGGTATCTGACTACAAGATCGTTGCCAGTCCCAAATTCAGTGAAGCCATCAGTGC
CGTGAGCTCGATTATCTTCGCCTACGCTGGCACACCGGCATTCTTCTCTATTGTATCGGAAATGCGCGACCCCAA
ATACTATACTCGCTCGTTGATCATCTGCCAAAGCAGCGTGACGGCTGTCTACGTTACCATCGGCGTTGTAGTCTA
CTACTACTGCGGCTCTTATGTTGCCTCGCCTGCTCTTGGCTCCGCCGGCGATACGATGAAGAAGGTCAGCTATGG
CTTTGCCATTCCAGGTCTTCTGGTTACTGTGATGCTGTTCGTTCATGTAAGCACTTCCTCTCTAGGTCTCTTTAT
CTATGCGATCCAGTCAACCTAACACATCACTGACAGTTGCCCGCGAAATTCGTCTTCGTCCGCGCCCTCAGAGGC
TCCAAACACCTCACCTCAAACAGCATGGTGCACTGGGGCTCGTGGATCGGCTGCACCGCAGCAGTCGGTCTTATT
TCCTACGTCATCGCAAGTGCCATTCCCGTCTTTGACAGTCTCGTCTCGCTTATCGGTGCTTTGCTCGGCACATTC
ATGTGTTTCCAACCCATGGGCTGCATGTGGCTGTACGATAATTGGGGTAAGGGGAAGGTCGACCGATCCCCGAGG
TGGATGTTCATGGTTTCCTGGAGTGTCTTTGTTATCGTCATCGGCAGTTTCATGATGGTCGCTGGTACATATGGG
TCTGTCGTCAGCATCATGGACAGCTACAAGGCGAACGGTGGTTCAGCTGCGTGGTCCTGTGCGGATAACTCAAAT
TCTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail