Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6371.t1
Gene name
Locationscaffold_17:8573..9537
Strand-
Gene length (bp)964
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 3.5E-52 66 266

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 71 88 17
2 103 122 19
3 129 151 22
4 156 178 22
5 185 207 22
6 211 230 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6371.t1
MAANTRYEPAPQRDSLDDPSYSRAPPSYEATAAPAESTPRGEDDNLPDDFKFGGTVAEGTIDIRMQFVRKVYSIL
TAQLLLTTILSSISFFNDSYRTWIQSNFWLMIISVFGALGFMLATFWKRKSYPTNLLFLSGFTVLEAYSISVATS
FYDAKVVVQALALTLGIFVALTLFACQTKYDFTDWMPYLFGALWFMVLFGFVAMFIPFNSTMEIIYGVLGALVFS
GYILVDTQLVMRHYHVEEEIAASISLYLDVLNLFMSILRILNGANNNN*
Coding >Pro_DTO377G3_2|g6371.t1
ATGGCTGCAAACACCAGATACGAGCCTGCTCCTCAGCGGGACTCCTTGGATGACCCGTCTTACTCCCGAGCCCCT
CCCTCCTACGAGGCCACAGCGGCTCCAGCGGAGTCAACGCCTCGTGGTGAGGATGACAATCTGCCGGATGATTTC
AAGTTCGGAGGTACCGTCGCCGAAGGAACGATTGACATCCGAATGCAATTCGTGCGCAAAGTGTACTCGATTCTA
ACGGCCCAACTCCTCCTTACAACGATCCTCAGCTCAATCTCCTTCTTTAACGACTCCTACCGCACCTGGATCCAG
TCCAACTTCTGGCTGATGATAATCTCAGTTTTCGGTGCTCTGGGATTCATGCTCGCAACATTCTGGAAACGAAAG
TCCTACCCGACCAACCTTCTTTTCCTATCAGGCTTCACCGTCCTTGAAGCGTACTCAATCAGCGTGGCGACATCT
TTCTACGATGCGAAAGTAGTGGTGCAAGCGCTCGCACTAACACTAGGAATCTTCGTCGCCTTGACGCTCTTTGCA
TGCCAGACTAAGTACGATTTCACCGACTGGATGCCATACCTGTTTGGCGCGTTGTGGTTCATGGTCCTGTTCGGG
TTCGTGGCTATGTTTATCCCATTCAACAGCACGATGGAGATCATCTATGGTGTTCTTGGCGCTCTCGTCTTCTCG
GGCTATATTCTCGTCGATACGCAGTTGGTTATGCGGCACTATCACGTTGAGGAGGAGATCGCTGCTTCGATCTCG
CTTTATCTCGACGTGCTTAACTTGTTCATGTCCATTCTGCGGATTCTGAACGGTGCTAACAACAACAACTAA
Transcript >Pro_DTO377G3_2|g6371.t1
ATGGCTGCAAACACCAGATACGAGCCTGCTCCTCAGCGGGACTCCTTGGATGACCCGTCTTACTCCCGAGCCCCT
CCCTCCTACGAGGCCACAGCGGCTCCAGCGGAGTCAACGCCTCGTGGTGAGGATGACAATCTGCCGGATGATTTC
AAGTTCGGAGGTACCGTCGCCGAAGGAACGATTGACATCCGAATGCAATTCGTGCGCAAAGTGTACTCGATTCTA
ACGGCCCAACTCCTCCTTACAACGATCCTCAGCTCAATCTCCTTCTTTAACGACTCCTACCGCACCTGGATCCAG
TCCAACTTCTGGCTGATGATAATCTCAGTTTTCGGTGCTCTGGGATTCATGCTCGCAACATTCTGGAAACGAAAG
TCCTACCCGACCAACCTTCTTTTCCTATCAGGCTTCACCGTCCTTGAAGCGTACTCAATCAGCGTGGCGACATCT
TTCTACGATGCGAAAGTAGTGGTGCAAGCGCTCGCACTAACACTAGGAATCTTCGTCGCCTTGACGCTCTTTGCA
TGCCAGACTAAGTACGATTTCACCGACTGGATGCCATACCTGTTTGGCGCGTTGTGGTTCATGGTCCTGTTCGGG
TTCGTGGCTATGTTTATCCCATTCAACAGCACGATGGAGATCATCTATGGTGTTCTTGGCGCTCTCGTCTTCTCG
GGCTATATTCTCGTCGATACGCAGTTGGTTATGCGGCACTATCACGTTGAGGAGGAGATCGCTGCTTCGATCTCG
CTTTATCTCGACGTGCTTAACTTGTTCATGTCCATTCTGCGGATTCTGAACGGTGCTAACAACAACAACTAA
Gene >Pro_DTO377G3_2|g6371.t1
ATGGCTGCAAACACCAGATACGAGCCTGCTCCTCAGCGGGACTCCTTGGATGACCCGTCTTACTCCCGAGCCCCT
CCCTCCTACGAGGCCACAGCGGCTCCAGCGGAGTCAACGCCTCGTGGTGAGGATGACAATCTGCCGGATGATTTC
AAGGTATGCATTTACCATGCCTTTTAGGGGTCTTGAGCCCGGCTAGAAAGACAGAAACTGATAAAATCGCATAGT
TCGGAGGTACCGTCGCCGAAGGAACGATTGACATCCGAATGCAATTCGTGCGCAAAGTGTACTCGATTCTGTAAG
TGCAACACGATTCACAAACGCAGACTCAAGTGCGTGGGCTCTAATATACTAACACTCCTCGCTCAGAACGGCCCA
ACTCCTCCTTACAACGATCCTCAGCTCAATCTCCTTCTTTAACGACTCCTACCGCACCTGGATCCAGTCCAACTT
CTGGCTGATGATAATCTCAGTTTTCGGTGCTCTGGGATTCATGCTCGCAACATTCTGGAAACGAAAGTCCTACCC
GACCAACCTTCTTTTCCTATCAGGCTTCACCGTCCTTGAAGCGTACTCAATCAGCGTGGCGACATCTTTCTACGA
TGCGAAAGTAGTGGTGCAAGCGCTCGCACTAACACTAGGAATCTTCGTCGCCTTGACGCTCTTTGCATGCCAGAC
TAAGTACGATTTCACCGACTGGATGCCATACCTGTTTGGCGCGTTGTGGTTCATGGTCCTGTTCGGGTTCGTGGC
TATGTTTATCCCATTCAACAGCACGATGGAGATCATCTATGGTGTTCTTGGCGCTCTCGTCTTCTCGGGCTATAT
TCTCGTCGATACGCAGTTGGTTATGCGGCACTATCACGTTGAGGAGGAGATCGCTGCTTCGATCTCGCTTTATCT
CGACGTGCTTAACTTGTTCATGTCCATTCTGCGGATTCTGAACGGTGCTAACAACAACAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail