Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6370.t1
Gene name
Locationscaffold_17:6239..7972
Strand+
Gene length (bp)1733
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.4E-92 33 427
PF03222 Trp_Tyr_perm Tryptophan/tyrosine permease family 2.2E-07 37 265

GO

GO Term Description Terminal node
GO:0003333 amino acid transmembrane transport Yes
GO:0046942 carboxylic acid transport No
GO:0071705 nitrogen compound transport No
GO:0098656 anion transmembrane transport No
GO:0006865 amino acid transport No
GO:0015849 organic acid transport No
GO:1905039 carboxylic acid transmembrane transport No
GO:0051179 localization No
GO:1903825 organic acid transmembrane transport No
GO:0006811 ion transport No
GO:0055085 transmembrane transport No
GO:0006810 transport No
GO:0015711 organic anion transport No
GO:0071702 organic substance transport No
GO:0006820 anion transport No
GO:0034220 ion transmembrane transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 62 84 22
3 111 133 22
4 153 175 22
5 182 204 22
6 219 238 19
7 259 281 22
8 296 318 22
9 366 388 22
10 392 414 22
11 476 498 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6370.t1
MEEAALGVGPSGGHQNMLRRRAARARPGDVVGEASWASSVINLVNTIIGAGVLAMPLAISRMGIVLGVCVILWSA
VTAGFGLYLQSLCAQYLDRGSASFFALSQITYPNAAVVFDCAIAIKCFGVGVSYLIIIGDLMPGVIQGFVGSEPG
YDFLVDRHFWVTFFMLIVIPISYLRRLDSLKYTSIAALVSMAYLVVLVVYKFVQGDTMKDRGPIRVGHWEGAVPT
LSSLPVIVFAFTCHQNMFSILNEIGNNSHFRTTAVVIASAGSAAATYILVAITGYLSFGNSVGGNIVGMYPPGVY
ATIGRAAIVMLVVFSYPLQCHPCRASVDAVLKWRPRAQVAGAESSPNRHPLLGPRGNRTPEPMSDLRFSIITTTI
LILSYLVAMTVSSLESVLAYVGSTGSTSISFILPGLFYYKISSPDSPTHQGLMKEDDEAEDDLSGDDDGDDGEGS
LARPLTESGLLHRGTRHWRKALLRRLSLALALYGLVVMVVCLVTNTFFKISH*
Coding >Pro_DTO377G3_2|g6370.t1
ATGGAGGAGGCCGCGCTCGGGGTTGGTCCATCCGGGGGACATCAGAATATGCTGCGCAGACGTGCAGCCCGTGCA
AGACCTGGAGATGTCGTGGGGGAGGCCAGTTGGGCCAGCAGTGTGATCAACCTGGTTAATACCATCATCGGTGCC
GGTGTGCTGGCGATGCCCCTAGCCATCTCCCGTATGGGAATCGTCCTCGGCGTCTGCGTCATTCTGTGGTCTGCG
GTCACCGCAGGATTCGGCCTCTACCTGCAATCACTATGCGCGCAATACCTAGACCGTGGAAGCGCCTCATTTTTT
GCTCTATCGCAAATAACATACCCCAATGCGGCTGTGGTCTTTGACTGTGCGATTGCGATCAAATGTTTCGGAGTC
GGCGTGAGCTATCTCATCATCATTGGAGATCTTATGCCGGGAGTGATACAGGGCTTTGTCGGTAGCGAGCCTGGA
TACGATTTTCTGGTGGACCGCCACTTCTGGGTTACATTTTTCATGCTGATCGTGATTCCTATTTCCTACCTGCGC
CGTTTGGATTCTTTGAAATATACGAGTATCGCGGCCTTGGTGTCCATGGCCTATTTGGTTGTCTTGGTTGTGTAT
AAGTTTGTTCAAGGAGACACGATGAAAGATCGGGGCCCGATTCGCGTGGGCCATTGGGAGGGCGCAGTTCCGACT
CTCAGCAGTCTGCCAGTTATTGTCTTTGCATTTACTTGCCATCAAAATATGTTCTCCATCCTCAACGAAATCGGC
AATAACAGCCATTTCCGCACAACCGCCGTTGTTATTGCCAGCGCCGGTAGTGCAGCTGCAACCTACATCCTCGTT
GCCATCACCGGGTACTTATCCTTTGGCAACAGCGTAGGCGGGAATATCGTCGGCATGTACCCACCGGGCGTGTAC
GCAACGATCGGCCGCGCCGCAATCGTCATGCTAGTAGTCTTCTCTTACCCACTACAATGCCACCCATGCCGCGCC
TCAGTCGATGCCGTCCTAAAATGGCGTCCCCGAGCACAAGTCGCTGGCGCAGAGAGCTCTCCAAACCGACACCCA
CTTCTAGGCCCGCGCGGAAACCGCACGCCAGAGCCAATGAGCGACCTTCGCTTCTCCATTATCACAACCACCATC
TTGATTCTGAGCTACCTAGTCGCCATGACCGTGTCCTCCCTTGAATCCGTGCTGGCATATGTCGGGAGCACTGGC
AGCACGAGCATCAGCTTCATTCTTCCGGGCTTGTTTTACTACAAGATCTCATCGCCCGACTCGCCTACCCACCAG
GGCTTAATGAAAGAGGACGATGAGGCGGAGGATGATCTCTCAGGAGATGACGACGGCGACGACGGCGAGGGTTCC
CTCGCTCGCCCATTGACAGAGAGTGGCCTTTTGCACCGTGGCACCCGCCACTGGCGCAAGGCGCTGCTTCGCCGA
CTCAGCCTGGCATTGGCTCTCTACGGCCTCGTCGTTATGGTGGTGTGTCTGGTTACGAACACCTTCTTCAAAATC
TCACATTAA
Transcript >Pro_DTO377G3_2|g6370.t1
ATGGAGGAGGCCGCGCTCGGGGTTGGTCCATCCGGGGGACATCAGAATATGCTGCGCAGACGTGCAGCCCGTGCA
AGACCTGGAGATGTCGTGGGGGAGGCCAGTTGGGCCAGCAGTGTGATCAACCTGGTTAATACCATCATCGGTGCC
GGTGTGCTGGCGATGCCCCTAGCCATCTCCCGTATGGGAATCGTCCTCGGCGTCTGCGTCATTCTGTGGTCTGCG
GTCACCGCAGGATTCGGCCTCTACCTGCAATCACTATGCGCGCAATACCTAGACCGTGGAAGCGCCTCATTTTTT
GCTCTATCGCAAATAACATACCCCAATGCGGCTGTGGTCTTTGACTGTGCGATTGCGATCAAATGTTTCGGAGTC
GGCGTGAGCTATCTCATCATCATTGGAGATCTTATGCCGGGAGTGATACAGGGCTTTGTCGGTAGCGAGCCTGGA
TACGATTTTCTGGTGGACCGCCACTTCTGGGTTACATTTTTCATGCTGATCGTGATTCCTATTTCCTACCTGCGC
CGTTTGGATTCTTTGAAATATACGAGTATCGCGGCCTTGGTGTCCATGGCCTATTTGGTTGTCTTGGTTGTGTAT
AAGTTTGTTCAAGGAGACACGATGAAAGATCGGGGCCCGATTCGCGTGGGCCATTGGGAGGGCGCAGTTCCGACT
CTCAGCAGTCTGCCAGTTATTGTCTTTGCATTTACTTGCCATCAAAATATGTTCTCCATCCTCAACGAAATCGGC
AATAACAGCCATTTCCGCACAACCGCCGTTGTTATTGCCAGCGCCGGTAGTGCAGCTGCAACCTACATCCTCGTT
GCCATCACCGGGTACTTATCCTTTGGCAACAGCGTAGGCGGGAATATCGTCGGCATGTACCCACCGGGCGTGTAC
GCAACGATCGGCCGCGCCGCAATCGTCATGCTAGTAGTCTTCTCTTACCCACTACAATGCCACCCATGCCGCGCC
TCAGTCGATGCCGTCCTAAAATGGCGTCCCCGAGCACAAGTCGCTGGCGCAGAGAGCTCTCCAAACCGACACCCA
CTTCTAGGCCCGCGCGGAAACCGCACGCCAGAGCCAATGAGCGACCTTCGCTTCTCCATTATCACAACCACCATC
TTGATTCTGAGCTACCTAGTCGCCATGACCGTGTCCTCCCTTGAATCCGTGCTGGCATATGTCGGGAGCACTGGC
AGCACGAGCATCAGCTTCATTCTTCCGGGCTTGTTTTACTACAAGATCTCATCGCCCGACTCGCCTACCCACCAG
GGCTTAATGAAAGAGGACGATGAGGCGGAGGATGATCTCTCAGGAGATGACGACGGCGACGACGGCGAGGGTTCC
CTCGCTCGCCCATTGACAGAGAGTGGCCTTTTGCACCGTGGCACCCGCCACTGGCGCAAGGCGCTGCTTCGCCGA
CTCAGCCTGGCATTGGCTCTCTACGGCCTCGTCGTTATGGTGGTGTGTCTGGTTACGAACACCTTCTTCAAAATC
TCACATTAA
Gene >Pro_DTO377G3_2|g6370.t1
ATGGAGGAGGCCGCGCTCGGGGTTGGTCCATCCGGGGGACATCAGAATATGCTGCGCAGGTAGGCCGGAGCCCAA
TATCTTGATGTTGATGGTGGCTAATTTGGATTCCATTAGACGTGCAGCCCGTGCAAGACCTGGAGATGTCGTGGG
GGAGGCCAGTTGGGCCAGCAGTGTGATCAACCTGGTTAATACCAGTAAGTGCGAGGAAGCGCACCATACAAGAGT
GCTCCGAATTCTGATACAATTTCTCCTGCAGTCATCGGTGCCGGTGTGCTGGCGATGCCCCTAGCCATCTCCCGT
ATGGGAATCGTCCTCGGCGTCTGCGTCATTCTGTGGTCTGCGGTCACCGCAGGATTCGGCCTCTACCTGCAATCA
CTATGCGCGCAATACCTAGACCGTGGAAGCGCCTCATTTTTTGCTCTATCGCAAATAACATACCCCAATGCGGCT
GTGGTCTTTGACTGTGCGATTGCGATCAAATGTTTCGGAGTCGGCGTGAGCTATCTCATCATCATTGGAGATCTT
ATGCCGGGAGTGATACAGGGCTTTGTCGGTAGCGAGCCTGGATACGATTTTCTGGTGGACCGCCACTTCTGGGTT
ACATTTTTCATGTGCGTAGCCTCGTGCATTTTGTCTAAACGAGGGGAAGTGCTGACCATTTGACTTTAGGCTGAT
CGTGATTCCTATTTCCTACCTGCGCCGTTTGGATTCTTTGAAATATACGAGTATCGCGGCCTTGGTGTCCATGGC
CTATTTGGTTGTCTTGGTTGTGTATAAGTTTGTTCAAGGAGACACGATGAAAGATCGGGGCCCGATTCGCGTGGG
CCATTGGGAGGGCGCAGTTCCGACTCTCAGCAGTCTGCCAGTTATTGTCTTTGCATTTACTTGCCATCAAAATGT
ACTTTCCCAAGTCGTGACTCGTCGGTTCTTTCTAACAAGCATTTTAGATGTTCTCCATCCTCAACGAAATCGGCA
ATAACAGCCATTTCCGCACAACCGCCGTTGTTATTGCCAGCGCCGGTAGTGCAGCTGCAACCTACATCCTCGTTG
CCATCACCGGGTACTTATCCTTTGGCAACAGCGTAGGCGGGAATATCGTCGGCATGTACCCACCGGGCGTGTACG
CAACGATCGGCCGCGCCGCAATCGTCATGCTAGTAGTCTTCTCTTACCCACTACAATGCCACCCATGCCGCGCCT
CAGTCGATGCCGTCCTAAAATGGCGTCCCCGAGCACAAGTCGCTGGCGCAGAGAGCTCTCCAAACCGACACCCAC
TTCTAGGCCCGCGCGGAAACCGCACGCCAGAGCCAATGAGCGACCTTCGCTTCTCCATTATCACAACCACCATCT
TGATTCTGAGCTACCTAGTCGCCATGACCGTGTCCTCCCTTGAATCCGTGCTGGCATATGTCGGGAGCACTGGCA
GCACGAGCATCAGCTTCATTCTTCCGGGCTTGTTTTACTACAAGATCTCATCGCCCGACTCGCCTACCCACCAGG
GCTTAATGAAAGAGGACGATGAGGCGGAGGATGATCTCTCAGGAGATGACGACGGCGACGACGGCGAGGGTTCCC
TCGCTCGCCCATTGACAGAGAGTGGCCTTTTGCACCGTGGCACCCGCCACTGGCGCAAGGCGCTGCTTCGCCGAC
TCAGCCTGGCATTGGCTCTCTACGGCCTCGTCGTTATGGTGGTGTGTCTGGTTACGAACACCTTCTTCAAAATCT
CACATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail