Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g637.t1
Gene name
Locationscaffold_01:1636886..1637788
Strand-
Gene length (bp)902
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 7.5E-57 34 269
PF00106 adh_short short chain dehydrogenase 1.4E-46 17 214

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.74 1.01 8.48
5d_25C Five days - 25 degrees Celsius 4.85 1.18 8.51
7d_25C Seven days - 25 degrees Celsius 7.32 2.22 12.42
10d_25C Ten days - 25 degrees Celsius 6.72 1.85 11.59
7d_15C Seven days - 15 degrees Celsius 10.99 3.90 18.07
7d_30C Seven days - 30 degrees Celsius 2.35 0.30 4.40

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.973812 no
3d_25C 7d_25C 0.340960 no
3d_25C 7d_15C 0.035668 yes
3d_25C 7d_30C 0.150197 no
3d_25C 10d_25C 0.493729 no
5d_25C 7d_25C 0.335674 no
5d_25C 7d_15C 0.023923 yes
5d_25C 7d_30C 0.115258 no
5d_25C 10d_25C 0.497247 no
7d_25C 7d_15C 0.304597 no
7d_25C 7d_30C 0.009770 yes
7d_25C 10d_25C 0.883615 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.227694 no
7d_30C 10d_25C 0.019090 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g637.t1
MESGIPSEPPSRSLVGKVAIVTGAGCLGDGIGNGRAISILLADDGCDVICVDLNLEWANKTVEIVNSKPGRGRAL
AIRGDVTSEEDCQEAVRFAVEQFGRLDILINNVGIGGAAGTAVEVDMMQWAKSMEINVASMVQMVKYAIPEMSRN
DGEIKGSIVNMGSVAGLKGGTPHLLYPTAKGAVVNMTRAMAAHHSLDGIRVNCVCPGMLYTPMMYGKGMSEEARE
ARRKRSLLGTEGNGWDCAGAVVFLAGPHARWMTGVILPVDAGTTAAVGIGMTKSASVNA*
Coding >Pro_DTO377G3_2|g637.t1
ATGGAGTCTGGCATTCCATCGGAACCCCCATCGCGTTCTTTAGTTGGCAAAGTCGCCATAGTAACAGGCGCAGGC
TGCCTAGGTGATGGAATTGGAAACGGACGCGCGATTTCAATCCTTCTTGCCGACGATGGCTGCGACGTAATCTGC
GTCGACCTCAACCTAGAGTGGGCGAACAAGACCGTGGAGATCGTGAACTCGAAACCCGGTCGTGGACGAGCGCTT
GCGATTCGGGGAGATGTCACATCCGAAGAAGACTGCCAAGAAGCGGTGCGCTTTGCAGTTGAACAGTTTGGACGA
CTGGATATTTTAATCAACAATGTCGGCATTGGAGGCGCGGCGGGCACTGCGGTGGAAGTTGATATGATGCAGTGG
GCTAAGAGTATGGAGATCAATGTTGCCAGCATGGTACAAATGGTCAAGTATGCCATTCCTGAGATGAGTCGAAAT
GATGGCGAGATCAAAGGGAGCATTGTGAACATGGGAAGTGTTGCTGGGTTGAAGGGTGGCACACCTCATCTGCTA
TACCCGACTGCCAAGGGTGCTGTAGTCAACATGACCCGTGCTATGGCGGCTCATCACTCTCTCGATGGGATCCGT
GTAAATTGTGTCTGTCCAGGAATGCTGTACACGCCTATGATGTATGGGAAGGGCATGAGCGAAGAGGCGCGTGAG
GCCCGTCGGAAACGAAGCTTATTGGGAACCGAAGGAAATGGATGGGACTGTGCTGGAGCTGTTGTATTCCTTGCT
GGACCTCATGCTCGGTGGATGACTGGTGTTATTCTGCCTGTTGACGCAGGGACAACAGCTGCTGTGGGAATTGGA
ATGACGAAGAGTGCAAGTGTCAATGCCTAA
Transcript >Pro_DTO377G3_2|g637.t1
ATGGAGTCTGGCATTCCATCGGAACCCCCATCGCGTTCTTTAGTTGGCAAAGTCGCCATAGTAACAGGCGCAGGC
TGCCTAGGTGATGGAATTGGAAACGGACGCGCGATTTCAATCCTTCTTGCCGACGATGGCTGCGACGTAATCTGC
GTCGACCTCAACCTAGAGTGGGCGAACAAGACCGTGGAGATCGTGAACTCGAAACCCGGTCGTGGACGAGCGCTT
GCGATTCGGGGAGATGTCACATCCGAAGAAGACTGCCAAGAAGCGGTGCGCTTTGCAGTTGAACAGTTTGGACGA
CTGGATATTTTAATCAACAATGTCGGCATTGGAGGCGCGGCGGGCACTGCGGTGGAAGTTGATATGATGCAGTGG
GCTAAGAGTATGGAGATCAATGTTGCCAGCATGGTACAAATGGTCAAGTATGCCATTCCTGAGATGAGTCGAAAT
GATGGCGAGATCAAAGGGAGCATTGTGAACATGGGAAGTGTTGCTGGGTTGAAGGGTGGCACACCTCATCTGCTA
TACCCGACTGCCAAGGGTGCTGTAGTCAACATGACCCGTGCTATGGCGGCTCATCACTCTCTCGATGGGATCCGT
GTAAATTGTGTCTGTCCAGGAATGCTGTACACGCCTATGATGTATGGGAAGGGCATGAGCGAAGAGGCGCGTGAG
GCCCGTCGGAAACGAAGCTTATTGGGAACCGAAGGAAATGGATGGGACTGTGCTGGAGCTGTTGTATTCCTTGCT
GGACCTCATGCTCGGTGGATGACTGGTGTTATTCTGCCTGTTGACGCAGGGACAACAGCTGCTGTGGGAATTGGA
ATGACGAAGAGTGCAAGTGTCAATGCCTAA
Gene >Pro_DTO377G3_2|g637.t1
ATGGAGTCTGGCATTCCATCGGAACCCCCATCGCGTTCTTTAGTTGGCAAAGTCGCCATAGTAACAGGCGCAGGC
TGCCTAGGTGATGGAATTGGAAACGGACGCGCGATTTCAATCCTTCTTGCCGACGATGGCTGCGACGTAATCTGC
GTCGACCTCAACCTAGAGTGGGCGAACAAGACCGTGGAGATCGTGAACTCGAAACCCGGTCGTGGACGAGCGCTT
GCGATTCGGGGAGATGTCACATCCGAAGAAGACTGCCAAGAAGCGGTGCGCTTTGCAGTTGAACAGTTTGGACGA
CTGGATATTTTAATCAACAATGTCGGCATTGGAGGCGCGGCGGGCACTGCGGTGGAAGTTGATATGATGCAGTGG
GCTAAGAGTATGGAGATCAATGTTGCCAGCATGGTACAAATGGTCAAGTATGCCATTCCTGAGATGAGTCGAAAT
GATGGCGAGATCAAAGGGAGCATTGTGAACATGGGAAGTGTTGCTGGGTTGAAGGGTGGCACACCTCATCTGCTA
TACCCGACTGCCAAGGGTGCTGTAGTCAACATGACCCGTGCTATGGCGGCTCATCACTCTCTCGATGGGATCCGT
GTAAATTGTGTCTGTCCAGGAGTATGTTTAACATGTTTGTTGTATGGAACTGAAGCTGATGATACTAGATGCTGT
ACACGCCTATGATGTATGGGAAGGGCATGAGCGAAGAGGCGCGTGAGGCCCGTCGGAAACGAAGCTTATTGGGAA
CCGAAGGAAATGGATGGGACTGTGCTGGAGCTGTTGTATTCCTTGCTGGACCTCATGCTCGGTGGATGACTGGTG
TTATTCTGCCTGTTGACGCAGGGACAACAGCTGCTGTGGGAATTGGAATGACGAAGAGTGCAAGTGTCAATGCCT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail