Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6368.t1
Gene name
Locationscaffold_17:2334..3817
Strand-
Gene length (bp)1483
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 1.7E-168 43 446

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 13.45 6.01 20.89
5d_25C Five days - 25 degrees Celsius 9.63 3.78 15.49
7d_25C Seven days - 25 degrees Celsius 7.82 2.79 12.85
10d_25C Ten days - 25 degrees Celsius 6.22 2.14 10.31
7d_15C Seven days - 15 degrees Celsius 7.84 2.80 12.89
7d_30C Seven days - 30 degrees Celsius 7.92 2.99 12.84

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.358858 no
3d_25C 7d_25C 0.108929 no
3d_25C 7d_15C 0.113673 no
3d_25C 7d_30C 0.100458 no
3d_25C 10d_25C 0.015833 yes
5d_25C 7d_25C 0.638081 no
5d_25C 7d_15C 0.640678 no
5d_25C 7d_30C 0.650749 no
5d_25C 10d_25C 0.233992 no
7d_25C 7d_15C 0.995217 no
7d_25C 7d_30C 0.984350 no
7d_25C 10d_25C 0.608026 no
7d_15C 7d_30C 0.987118 no
7d_15C 10d_25C 0.600453 no
7d_30C 10d_25C 0.562905 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6368.t1
MSLSKFISRSAVRAASTSTQTTKAAGDISSVFPSLRPDYKPEPLPARFQDLKAQIFEKNKDAITKSWERLLPSLD
EEVQKIKAKGSDIIPSIDYSDVISGNVSEAALKEIRHRGSAVVRNVVPRDQALEYKQRIRDYVAANKERVKAFPA
DSPAVYELYWTPSQAEARGHSNMLNTQRFMQQLWHSSDPNSKISTTNPLTYADRLRIRDPGDSKFTLGPHIDGGS
LERWEDPEYSRVYTKILEGNWEQYDAWDARHRLSANMDLYNGAGACSMLRFFQAWLSMSDTKPGEGSLHVCPMIN
HSTAYTILRPFFDVETSKPALDATFPGSVPGACQEYNPVTHPHLDLESTMVSVPEVAPGDFVAWHCDSLHSVDKE
HRGTQDSSVMYIPATPLCDMNVKYLLKQRQAALNYSPPWDFPGAGGPGESGFKGAMDWSALSPEGQRAMGLGNTP
WEITDAMSEGEKEAIRSANKACFGV*
Coding >Pro_DTO377G3_2|g6368.t1
ATGTCTCTATCAAAGTTTATCTCAAGATCCGCTGTCCGAGCGGCCTCTACCTCGACCCAGACAACCAAGGCCGCC
GGTGATATCTCATCCGTTTTCCCCAGCTTAAGGCCCGACTACAAGCCAGAACCTCTCCCCGCACGGTTTCAAGAT
CTGAAAGCGCAAATCTTCGAGAAAAACAAAGATGCAATTACAAAGAGTTGGGAGCGCTTGCTCCCTAGCTTGGAT
GAAGAAGTGCAAAAGATCAAGGCAAAGGGCAGCGACATCATTCCCTCAATTGATTACTCTGATGTGATCTCTGGA
AATGTGTCTGAGGCTGCATTAAAAGAAATCCGCCACCGAGGCAGTGCGGTCGTCCGCAATGTAGTCCCCCGGGAC
CAAGCCCTAGAGTATAAGCAGCGCATTCGCGACTATGTGGCCGCCAACAAAGAACGAGTCAAGGCCTTCCCGGCT
GACTCCCCAGCTGTCTACGAGCTGTACTGGACTCCATCACAGGCCGAAGCCCGCGGTCACAGCAACATGCTCAAC
ACCCAGCGCTTCATGCAGCAGCTGTGGCATTCATCCGACCCTAACAGCAAGATCTCAACCACCAATCCGCTCACC
TACGCAGATCGTCTACGCATCCGCGATCCAGGCGACTCAAAATTCACCCTCGGTCCGCACATTGACGGTGGGTCC
CTCGAGCGCTGGGAAGACCCCGAGTACTCTCGAGTCTACACCAAGATCCTCGAAGGTAACTGGGAACAATACGAC
GCATGGGATGCGCGACACCGTCTGAGCGCCAACATGGACCTATACAATGGCGCCGGTGCATGCTCCATGTTGCGG
TTCTTCCAGGCCTGGCTATCTATGTCGGACACCAAGCCTGGCGAGGGCTCGTTGCACGTCTGCCCCATGATCAAC
CACAGCACAGCATACACTATCCTGCGTCCGTTCTTCGACGTCGAAACCTCAAAACCGGCCTTGGATGCTACATTC
CCTGGCTCCGTGCCTGGCGCTTGCCAGGAGTACAACCCGGTTACACACCCGCATCTCGATCTCGAGTCGACTATG
GTTTCAGTACCGGAGGTTGCGCCTGGTGATTTTGTTGCGTGGCACTGCGATTCTCTTCATTCCGTGGACAAGGAG
CACCGTGGTACCCAGGACTCTAGTGTTATGTACATTCCCGCTACCCCGCTGTGCGACATGAATGTGAAATACCTT
CTTAAGCAGCGCCAGGCTGCGCTGAACTATTCGCCTCCGTGGGATTTCCCCGGTGCTGGTGGGCCCGGTGAGTCG
GGATTCAAGGGTGCTATGGATTGGTCGGCGCTGAGCCCAGAGGGTCAGCGTGCTATGGGCTTAGGCAACACCCCT
TGGGAGATCACCGACGCAATGAGCGAGGGTGAGAAGGAAGCCATCCGGTCTGCCAATAAGGCCTGTTTCGGTGTT
TAA
Transcript >Pro_DTO377G3_2|g6368.t1
ATGTCTCTATCAAAGTTTATCTCAAGATCCGCTGTCCGAGCGGCCTCTACCTCGACCCAGACAACCAAGGCCGCC
GGTGATATCTCATCCGTTTTCCCCAGCTTAAGGCCCGACTACAAGCCAGAACCTCTCCCCGCACGGTTTCAAGAT
CTGAAAGCGCAAATCTTCGAGAAAAACAAAGATGCAATTACAAAGAGTTGGGAGCGCTTGCTCCCTAGCTTGGAT
GAAGAAGTGCAAAAGATCAAGGCAAAGGGCAGCGACATCATTCCCTCAATTGATTACTCTGATGTGATCTCTGGA
AATGTGTCTGAGGCTGCATTAAAAGAAATCCGCCACCGAGGCAGTGCGGTCGTCCGCAATGTAGTCCCCCGGGAC
CAAGCCCTAGAGTATAAGCAGCGCATTCGCGACTATGTGGCCGCCAACAAAGAACGAGTCAAGGCCTTCCCGGCT
GACTCCCCAGCTGTCTACGAGCTGTACTGGACTCCATCACAGGCCGAAGCCCGCGGTCACAGCAACATGCTCAAC
ACCCAGCGCTTCATGCAGCAGCTGTGGCATTCATCCGACCCTAACAGCAAGATCTCAACCACCAATCCGCTCACC
TACGCAGATCGTCTACGCATCCGCGATCCAGGCGACTCAAAATTCACCCTCGGTCCGCACATTGACGGTGGGTCC
CTCGAGCGCTGGGAAGACCCCGAGTACTCTCGAGTCTACACCAAGATCCTCGAAGGTAACTGGGAACAATACGAC
GCATGGGATGCGCGACACCGTCTGAGCGCCAACATGGACCTATACAATGGCGCCGGTGCATGCTCCATGTTGCGG
TTCTTCCAGGCCTGGCTATCTATGTCGGACACCAAGCCTGGCGAGGGCTCGTTGCACGTCTGCCCCATGATCAAC
CACAGCACAGCATACACTATCCTGCGTCCGTTCTTCGACGTCGAAACCTCAAAACCGGCCTTGGATGCTACATTC
CCTGGCTCCGTGCCTGGCGCTTGCCAGGAGTACAACCCGGTTACACACCCGCATCTCGATCTCGAGTCGACTATG
GTTTCAGTACCGGAGGTTGCGCCTGGTGATTTTGTTGCGTGGCACTGCGATTCTCTTCATTCCGTGGACAAGGAG
CACCGTGGTACCCAGGACTCTAGTGTTATGTACATTCCCGCTACCCCGCTGTGCGACATGAATGTGAAATACCTT
CTTAAGCAGCGCCAGGCTGCGCTGAACTATTCGCCTCCGTGGGATTTCCCCGGTGCTGGTGGGCCCGGTGAGTCG
GGATTCAAGGGTGCTATGGATTGGTCGGCGCTGAGCCCAGAGGGTCAGCGTGCTATGGGCTTAGGCAACACCCCT
TGGGAGATCACCGACGCAATGAGCGAGGGTGAGAAGGAAGCCATCCGGTCTGCCAATAAGGCCTGTTTCGGTGTT
TAA
Gene >Pro_DTO377G3_2|g6368.t1
ATGTCTCTATCAAAGTTTATCTCAAGATCCGCTGTCCGAGCGGCCTCTACCTCGACCCAGACAACCAAGGCCGCC
GGTGATATCTCATCCGTTTTCCCCAGCTTAAGGCCCGACTACAAGCCAGAACCTCTCCCCGCACGGTTTCAAGAT
CTGAAAGCGCAAATCTTCGAGAAAAACAAAGATGCAATTACAAAGAGTTGGGAGCGCTTGCTCCCTAGCTTGGAT
GAAGAAGTGCAAAAGATCAAGGCAAAGGGCAGCGACGTACGTGCACATGTAACCCGCAACACCGAGCAAAAGACT
GACTTTCAAATACCAGATCATTCCCTCAATTGATTACTCTGATGTGATCTCTGGAAATGTGTCTGAGGCTGCATT
AAAAGAAATCCGCCACCGAGGCAGTGCGGTCGTCCGCAATGTAGTCCCCCGGGACCAAGCCCTAGAGTATAAGCA
GCGCATTCGCGACTATGTGGCCGCCAACAAAGAACGAGTCAAGGCCTTCCCGGCTGACTCCCCAGCTGTCTACGA
GCTGTACTGGACTCCATCACAGGCCGAAGCCCGCGGTCACAGCAACATGCTCAACACCCAGCGCTTCATGCAGCA
GCTGTGGCATTCATCCGACCCTAACAGCAAGATCTCAACCACCAATCCGCTCACCTACGCAGATCGTCTACGCAT
CCGCGATCCAGGCGACTCAAAATTCACCCTCGGTCCGCACATTGACGGTGGGTCCCTCGAGCGCTGGGAAGACCC
CGAGTACTCTCGAGTCTACACCAAGATCCTCGAAGGTAACTGGGAACAATACGACGCATGGGATGCGCGACACCG
TCTGAGCGCCAACATGGACCTATACAATGGCGCCGGTGCATGCTCCATGTTGCGGTTCTTCCAGGCCTGGCTATC
TATGTCGGACACCAAGCCTGGCGAGGGCTCGTTGCACGTCTGCCCCATGATCAACCACAGCACAGCATACACTAT
CCTGCGTCCGTTCTTCGACGTCGAAACCTCAAAACCGGCCTTGGATGCTACATTCCCTGGCTCCGTGCCTGGCGC
TTGCCAGGAGTACAACCCGGTTACACACCCGCATCTCGATCTCGAGTCGACTATGGTTTCAGTACCGGAGGTTGC
GCCTGGTGATTTTGTTGCGTGGCACTGCGATTCTCTTCATTCCGTGGACAAGGAGCACCGTGGTACCCAGGACTC
TAGTGTTATGTACATTCCCGCTACCCCGCTGTGCGACATGAATGTGAAATACCTTCTTAAGCAGCGCCAGGCTGC
GCTGAACTATTCGCCTCCGTGGGATTTCCCCGGTGCTGGTGGGCCCGGTGAGTCGGGATTCAAGGGTGCTATGGA
TTGGTCGGCGCTGAGCCCAGAGGGTCAGCGTGCTATGGGCTTAGGCAACACCCCTTGGGAGATCACCGACGCAAT
GAGCGAGGGTGAGAAGGAAGCCATCCGGTCTGCCAATAAGGCCTGTTTCGGTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail