Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6365.t1
Gene name
Locationscaffold_16:611865..613344
Strand+
Gene length (bp)1479
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 7.5E-09 130 355

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 45.42 26.25 64.58
5d_25C Five days - 25 degrees Celsius 49.92 29.27 70.57
7d_25C Seven days - 25 degrees Celsius 51.22 30.07 72.37
10d_25C Ten days - 25 degrees Celsius 44.48 25.66 63.29
7d_15C Seven days - 15 degrees Celsius 44.02 25.14 62.89
7d_30C Seven days - 30 degrees Celsius 35.75 19.70 51.80

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.762283 no
3d_25C 7d_25C 0.686838 no
3d_25C 7d_15C 0.932636 no
3d_25C 7d_30C 0.374648 no
3d_25C 10d_25C 0.956705 no
5d_25C 7d_25C 0.941171 no
5d_25C 7d_15C 0.674732 no
5d_25C 7d_30C 0.175546 no
5d_25C 10d_25C 0.693798 no
7d_25C 7d_15C 0.599037 no
7d_25C 7d_30C 0.141897 no
7d_25C 10d_25C 0.621381 no
7d_15C 7d_30C 0.464178 no
7d_15C 10d_25C 0.978492 no
7d_30C 10d_25C 0.429622 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6365.t1
MVELKPIFRKAYWSLAAGGLLYVLCILSLTFPEVQRSVLYANKINPSLWQDVNQVEQFGFLRTQVQPFHLVTPDN
ETIYGWHLMPLHLCLEFEKELMENPSTGPAEDYTKTVAYKLLANDPNARVVVSFHGNAAHLGSAQRPATYNSMLS
LSTPSNPVHVFAIDYRGFGVSTGNPTEEGLITDGVSLINFLTAGPLEVPTSRIVIVGQSLGTAVTTAVAERFAFG
SSDPAAIQPAIKNADPFAGVVLLASFSSLANLIESYSFKGLTPPMLSPIMGYPRSQQWLLSHIVDHWDTAGRLAR
LTGVNTTSLNAVDMGYIDKSLDLTIVHAFDDAEIPWYEGRRVWEAATGRHVKGAPGAMTYLKSEDGNPSEVKIWK
NEISNEDGSEVVKTVRWERIRYGGHNRVASGSVAGIAVMRAFEQ*
Coding >Pro_DTO377G3_2|g6365.t1
ATGGTTGAGCTTAAGCCTATTTTTAGGAAGGCTTACTGGTCCCTTGCAGCAGGTGGCCTGCTATACGTGCTGTGT
ATCCTCTCCTTGACCTTCCCAGAGGTTCAACGTTCTGTTCTTTATGCCAACAAGATCAATCCCAGCTTGTGGCAG
GATGTCAACCAAGTCGAACAGTTTGGATTTTTAAGAACCCAAGTCCAACCGTTTCATTTGGTTACGCCCGACAAT
GAAACCATTTACGGCTGGCATTTGATGCCCTTGCATCTTTGCCTGGAGTTCGAAAAGGAATTAATGGAGAATCCC
TCTACGGGCCCAGCGGAGGACTACACGAAGACAGTTGCCTACAAGCTTCTCGCCAATGACCCCAATGCACGAGTT
GTGGTTAGCTTCCACGGAAATGCGGCGCATTTGGGTTCCGCTCAACGCCCTGCCACTTACAACTCGATGCTAAGC
CTATCTACCCCATCAAACCCAGTCCACGTCTTTGCAATTGACTATCGCGGCTTTGGTGTTAGCACTGGAAATCCC
ACCGAGGAAGGCCTTATCACGGATGGTGTGTCCCTCATTAACTTCCTTACCGCAGGGCCATTAGAGGTTCCCACC
TCCCGCATCGTCATCGTGGGCCAAAGTCTTGGAACTGCAGTAACAACTGCAGTGGCAGAGCGTTTTGCATTCGGA
TCATCTGACCCAGCAGCTATCCAACCGGCTATCAAGAACGCCGATCCATTTGCTGGCGTGGTCCTATTGGCATCT
TTCAGCAGCCTAGCCAATCTCATCGAGTCCTACAGCTTCAAAGGCCTCACCCCGCCTATGCTCTCTCCTATCATG
GGATATCCTCGATCTCAACAGTGGCTGTTGAGCCACATTGTGGACCACTGGGACACGGCTGGGAGACTGGCGCGT
CTCACCGGCGTTAATACTACTTCCTTGAACGCTGTAGATATGGGCTACATTGATAAAAGCCTTGATCTCACGATA
GTTCATGCTTTTGATGATGCTGAAATTCCCTGGTATGAAGGACGCCGCGTTTGGGAGGCTGCGACGGGCAGACAT
GTCAAGGGTGCTCCTGGTGCTATGACGTATCTCAAATCCGAGGATGGCAACCCTAGCGAGGTCAAGATCTGGAAG
AATGAGATCAGCAATGAAGATGGTAGTGAGGTTGTCAAAACAGTCAGATGGGAACGGATTCGATACGGTGGTCAC
AATCGCGTTGCATCAGGCTCAGTGGCTGGTATCGCTGTTATGAGGGCTTTTGAGCAGTAA
Transcript >Pro_DTO377G3_2|g6365.t1
ATGGTTGAGCTTAAGCCTATTTTTAGGAAGGCTTACTGGTCCCTTGCAGCAGGTGGCCTGCTATACGTGCTGTGT
ATCCTCTCCTTGACCTTCCCAGAGGTTCAACGTTCTGTTCTTTATGCCAACAAGATCAATCCCAGCTTGTGGCAG
GATGTCAACCAAGTCGAACAGTTTGGATTTTTAAGAACCCAAGTCCAACCGTTTCATTTGGTTACGCCCGACAAT
GAAACCATTTACGGCTGGCATTTGATGCCCTTGCATCTTTGCCTGGAGTTCGAAAAGGAATTAATGGAGAATCCC
TCTACGGGCCCAGCGGAGGACTACACGAAGACAGTTGCCTACAAGCTTCTCGCCAATGACCCCAATGCACGAGTT
GTGGTTAGCTTCCACGGAAATGCGGCGCATTTGGGTTCCGCTCAACGCCCTGCCACTTACAACTCGATGCTAAGC
CTATCTACCCCATCAAACCCAGTCCACGTCTTTGCAATTGACTATCGCGGCTTTGGTGTTAGCACTGGAAATCCC
ACCGAGGAAGGCCTTATCACGGATGGTGTGTCCCTCATTAACTTCCTTACCGCAGGGCCATTAGAGGTTCCCACC
TCCCGCATCGTCATCGTGGGCCAAAGTCTTGGAACTGCAGTAACAACTGCAGTGGCAGAGCGTTTTGCATTCGGA
TCATCTGACCCAGCAGCTATCCAACCGGCTATCAAGAACGCCGATCCATTTGCTGGCGTGGTCCTATTGGCATCT
TTCAGCAGCCTAGCCAATCTCATCGAGTCCTACAGCTTCAAAGGCCTCACCCCGCCTATGCTCTCTCCTATCATG
GGATATCCTCGATCTCAACAGTGGCTGTTGAGCCACATTGTGGACCACTGGGACACGGCTGGGAGACTGGCGCGT
CTCACCGGCGTTAATACTACTTCCTTGAACGCTGTAGATATGGGCTACATTGATAAAAGCCTTGATCTCACGATA
GTTCATGCTTTTGATGATGCTGAAATTCCCTGGTATGAAGGACGCCGCGTTTGGGAGGCTGCGACGGGCAGACAT
GTCAAGGGTGCTCCTGGTGCTATGACGTATCTCAAATCCGAGGATGGCAACCCTAGCGAGGTCAAGATCTGGAAG
AATGAGATCAGCAATGAAGATGGTAGTGAGGTTGTCAAAACAGTCAGATGGGAACGGATTCGATACGGTGGTCAC
AATCGCGTTGCATCAGGCTCAGTGGCTGGTATCGCTGTTATGAGGGCTTTTGAGCAGTAA
Gene >Pro_DTO377G3_2|g6365.t1
ATGGTTGAGCTTAAGCCTATTTTTAGGAAGGCTTACTGGTCCCTTGCAGCAGGTGGCCTGCTATACGTGCTGTGT
ATCCTCTCCTTGACCTTCCCAGAGGTTCAACGTTCGTATGTATCTAGTTCCCCCCGGGCCTACCTCCAGAGTGAG
CTAATATAGATAACACAGTGTTCTTTATGCCAACAAGATCAATCCCAGCTTGTGGCAGGATGTCAACCAAGTCGA
ACAGTTTGGATTTTTAAGTATGGCATCCCTAGGGGAACAACGGAAGTATGTTTGCTAACCGATCCCCAAAGGAAC
CCAAGTCCAACCGTTTCATTTGGTTACGCCCGACAATGAAACCATTTACGGCTGGCATTTGATGCCCTTGCATCT
TTGCCTGGAGTTCGAAAAGGAATTAATGGAGAATCCCTCTACGGGCCCAGCGGAGGACTACACGAAGACAGTTGC
CTACAAGCTTCTCGCCAATGACCCCAATGCACGAGTTGTGGTTAGCTGTAAGTGATAGACAACCTAGATTCCGAC
TGCAAAAAACTGACAGGCAAGTCCACGGAAATGCGGCGCATTTGGGTTCCGCTCAACGCCCTGCCACTTACAACT
CGATGCTAAGCCTATCTACCCCATCAAACCCAGTCCACGTCTTTGCAATTGACTATCGCGGCTTTGGTGTTAGCA
CTGGAAATCCCACCGAGGAAGGCCTTATCACGGATGGTGTGTCCCTCATTAACTTCCTTACCGCAGGGCCATTAG
AGGTTCCCACCTCCCGCATCGTCATCGTGGGCCAAAGTCTTGGAACTGCAGTAACAACTGCAGTGGCAGAGCGTT
TTGCATTCGGATCATCTGACCCAGCAGCTATCCAACCGGCTATCAAGAACGCCGATCCATTTGCTGGCGTGGTCC
TATTGGCATCTTTCAGCAGCCTAGCCAATCTCATCGAGTCCTACAGCTTCAAAGGCCTCACCCCGCCTATGCTCT
CTCCTATCATGGGATATCCTCGATCTCAACAGTGGCTGTTGAGCCACATTGTGGACCACTGGGACACGGCTGGGA
GACTGGCGCGTCTCACCGGCGTTAATACTACTTCCTTGAACGCTGTAGATATGGGCTACATTGATAAAAGCCTTG
ATCTCACGATAGTTCATGCTTTTGATGATGCTGAAATTCCCTGGTATGAAGGACGCCGCGTTTGGGAGGCTGCGA
CGGGCAGACATGTCAAGGGTGCTCCTGGTGCTATGACGTATCTCAAATCCGAGGATGGCAACCCTAGCGAGGTCA
AGATCTGGAAGAATGAGATCAGCAATGAAGATGGTAGTGAGGTTGTCAAAACAGTCAGATGGGAACGGATTCGAT
ACGGTGGTATGTTGAAGCAACACCCTCTGGCTATAAATTCGACAGACTGACCATAATCTTTTAGGTCACAATCGC
GTTGCATCAGGCTCAGTGGCTGGTATCGCTGTTATGAGGGCTTTTGAGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail