Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6351.t1
Gene name
Locationscaffold_16:578048..578777
Strand-
Gene length (bp)729
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 4.1E-27 32 83

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 70 87 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 172.78 102.35 243.21
5d_25C Five days - 25 degrees Celsius 274.02 166.79 381.25
7d_25C Seven days - 25 degrees Celsius 289.13 175.90 402.36
10d_25C Ten days - 25 degrees Celsius 385.14 234.85 535.42
7d_15C Seven days - 15 degrees Celsius 262.82 157.44 368.19
7d_30C Seven days - 30 degrees Celsius 286.18 171.01 401.35

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.029092 yes
3d_25C 7d_25C 0.012904 yes
3d_25C 7d_15C 0.053498 no
3d_25C 7d_30C 0.015558 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.866931 no
5d_25C 7d_15C 0.902659 no
5d_25C 7d_30C 0.895879 no
5d_25C 10d_25C 0.124773 no
7d_25C 7d_15C 0.750237 no
7d_25C 7d_30C 0.976919 no
7d_25C 10d_25C 0.208064 no
7d_15C 7d_30C 0.781589 no
7d_15C 10d_25C 0.081084 no
7d_30C 10d_25C 0.193405 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6351.t1
MNREPVPSSFDEENPQFTEETGVQKFKRRLKEEPLVPLGCAATCYALYRAYRSMKIGDSVEMNRMFRARIYAQAF
TLVALVAGGMYFKTERQQRREFDQAVELRKKQEKRDAWLRELEIRDKEDREWRERHAAIDAAAKEAGNKPAPRSE
SEAARSSIEPADEKSIGVMDAVRALISRN*
Coding >Pro_DTO377G3_2|g6351.t1
ATGAACCGGGAACCTGTTCCTTCGTCTTTTGACGAGGAGAACCCTCAATTTACAGAAGAGACCGGCGTTCAAAAA
TTCAAACGACGTCTCAAGGAAGAACCCCTGGTTCCACTTGGATGCGCCGCAACATGTTATGCCCTCTACCGCGCC
TACCGGTCGATGAAAATCGGTGACTCGGTTGAAATGAACCGAATGTTCCGAGCCCGTATCTACGCACAAGCCTTC
ACACTAGTCGCCCTAGTCGCCGGCGGAATGTACTTCAAGACGGAGCGGCAACAGCGCCGGGAATTCGACCAAGCA
GTGGAACTTCGGAAGAAGCAAGAAAAGCGTGATGCGTGGTTGCGCGAGCTAGAGATTCGTGATAAGGAGGATCGC
GAGTGGAGGGAGCGTCACGCTGCTATTGACGCTGCGGCCAAGGAGGCCGGGAATAAACCGGCGCCTCGTTCTGAG
TCTGAAGCGGCACGGTCATCGATCGAGCCTGCGGATGAGAAGTCTATTGGGGTTATGGATGCCGTCAGGGCTCTT
ATCTCGCGGAACTGA
Transcript >Pro_DTO377G3_2|g6351.t1
ATGAACCGGGAACCTGTTCCTTCGTCTTTTGACGAGGAGAACCCTCAATTTACAGAAGAGACCGGCGTTCAAAAA
TTCAAACGACGTCTCAAGGAAGAACCCCTGGTTCCACTTGGATGCGCCGCAACATGTTATGCCCTCTACCGCGCC
TACCGGTCGATGAAAATCGGTGACTCGGTTGAAATGAACCGAATGTTCCGAGCCCGTATCTACGCACAAGCCTTC
ACACTAGTCGCCCTAGTCGCCGGCGGAATGTACTTCAAGACGGAGCGGCAACAGCGCCGGGAATTCGACCAAGCA
GTGGAACTTCGGAAGAAGCAAGAAAAGCGTGATGCGTGGTTGCGCGAGCTAGAGATTCGTGATAAGGAGGATCGC
GAGTGGAGGGAGCGTCACGCTGCTATTGACGCTGCGGCCAAGGAGGCCGGGAATAAACCGGCGCCTCGTTCTGAG
TCTGAAGCGGCACGGTCATCGATCGAGCCTGCGGATGAGAAGTCTATTGGGGTTATGGATGCCGTCAGGGCTCTT
ATCTCGCGGAACTGA
Gene >Pro_DTO377G3_2|g6351.t1
ATGAACCGGGAACCTGTTCCTTCGTCTTTTGACGAGGAGAACCCGTATGTATCACACATTAGCCGCGTGCTCCGC
AAGCGGAACCCGACAATGCCGCAGAGGAAGCGAAGGGAAGGCTCGTCTGCTAACACTCGGTCTCGGACAGTCAAT
TTACAGAAGAGACCGGCGTTCAAAAATTCAAACGACGTCTCAAGGAAGAACCCCTGGTTCCACTTGGTACGAAAT
CCATCTGCACAAGCCCTCATCTTGACTTTGGAATTTCCCTCCCAACATTGAAAACCAAAACTAATACATACTGCC
ACAGGATGCGCCGCAACATGTTATGCCCTCTACCGCGCCTACCGGTCGATGAAAATCGGTGACTCGGTTGAAATG
AACCGAATGTTCCGAGCCCGTATCTACGCACAAGCCTTCACACTAGTCGCCCTAGTCGCCGGCGGAATGTACTTC
AAGACGGAGCGGCAACAGCGCCGGGAATTCGACCAAGCAGTGGAACTTCGGAAGAAGCAAGAAAAGCGTGATGCG
TGGTTGCGCGAGCTAGAGATTCGTGATAAGGAGGATCGCGAGTGGAGGGAGCGTCACGCTGCTATTGACGCTGCG
GCCAAGGAGGCCGGGAATAAACCGGCGCCTCGTTCTGAGTCTGAAGCGGCACGGTCATCGATCGAGCCTGCGGAT
GAGAAGTCTATTGGGGTTATGGATGCCGTCAGGGCTCTTATCTCGCGGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail