Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6339.t1
Gene name
Locationscaffold_16:555041..556531
Strand-
Gene length (bp)1490
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 3.5E-124 14 387

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 90 112 22
3 133 155 22
4 179 201 22
5 222 244 22
6 277 299 22
7 312 334 22
8 349 371 22
9 378 400 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6339.t1
MAVDRRKIAVFGAAFVLRLLLTCLFPSLPDLLTGRVEVSTPVNSFKRLQEGLFLYTRNVSPYDGGVFHQAPLLLP
LFALLPDAKSWPLPTAIFYFLVDLMNAYALMTISASGQSVKSRLHSAVRKHVRWDGVSVAAWFLFNPLTIATCLA
RSTSVFTTSGILFAISNAVGGNSINAMLALGFASYLSLYPALLFIPLVLLCYDRRLEGPSPPSAGSFIIQHAILL
LASVAGLLGLSCLITGNFWEFISATYGFHLLVPDLTPNVGLWWYFFIEMFDSFREFFLGVFWLHLASYVGGLTAR
FRSQPLFVITSLLGVFAVFKPYPSISDASLFFALLPLYRHLFPLMRYTFFAGSAILYSSLLGPAFYHLWIYAGSG
NANFFYAITLVWSLGLSILLADTIFAALRDEWEQEHPEQVGTEVRQV*
Coding >Pro_DTO377G3_2|g6339.t1
ATGGCTGTAGACCGACGGAAGATTGCTGTATTTGGCGCAGCTTTCGTGCTGCGTCTGCTTCTTACATGTCTTTTT
CCTTCATTGCCTGATTTGTTAACGGGGAGAGTCGAAGTCTCAACACCTGTTAATAGCTTCAAACGCCTGCAAGAA
GGCCTTTTCTTGTACACAAGAAATGTGTCGCCTTATGATGGTGGCGTCTTCCACCAGGCACCGCTCCTGTTACCT
CTGTTTGCCCTACTCCCGGATGCGAAGAGCTGGCCCTTGCCAACAGCAATTTTCTACTTCCTTGTCGACCTCATG
AACGCGTACGCATTGATGACTATATCTGCGTCGGGCCAGTCAGTCAAATCGAGACTACACTCAGCAGTCCGAAAA
CATGTTCGATGGGATGGAGTGTCCGTTGCAGCATGGTTCTTGTTCAATCCCCTTACTATTGCGACATGTTTAGCG
CGGTCAACCAGCGTATTTACGACATCCGGAATCCTCTTCGCCATCTCCAATGCAGTCGGCGGAAATAGCATCAAT
GCGATGCTAGCCCTTGGATTTGCTTCATACCTGTCTCTGTACCCGGCGCTGCTATTTATCCCGTTGGTCTTGCTA
TGCTATGACCGGCGGTTGGAGGGACCTAGCCCACCCAGTGCTGGATCGTTCATTATCCAACATGCTATCCTACTG
CTAGCCAGTGTGGCAGGCCTGCTTGGCCTATCCTGTCTGATCACCGGCAACTTTTGGGAGTTTATCTCGGCAACA
TATGGTTTCCATCTTTTGGTTCCAGACTTGACTCCGAACGTGGGGCTGTGGTGGTACTTTTTTATTGAGATGTTC
GACTCATTTCGAGAGTTCTTCCTCGGCGTTTTCTGGCTTCATTTGGCCAGCTATGTCGGGGGTCTCACTGCTCGC
TTCCGAAGTCAGCCATTATTCGTGATTACCTCGCTATTGGGTGTCTTCGCCGTGTTCAAGCCATACCCTAGCATC
TCAGATGCATCACTGTTCTTCGCATTGCTACCATTATATCGCCACCTTTTCCCATTGATGCGTTATACCTTCTTT
GCGGGCTCGGCAATCTTGTACTCCAGTCTTCTCGGTCCGGCTTTCTACCACCTTTGGATCTACGCAGGATCCGGA
AATGCCAATTTCTTCTACGCCATCACTCTAGTCTGGAGTTTGGGCCTCTCCATCCTCCTGGCCGACACCATCTTT
GCCGCTCTCAGAGACGAGTGGGAGCAAGAACACCCAGAGCAAGTGGGCACAGAGGTGCGACAGGTGTAG
Transcript >Pro_DTO377G3_2|g6339.t1
ATGGCTGTAGACCGACGGAAGATTGCTGTATTTGGCGCAGCTTTCGTGCTGCGTCTGCTTCTTACATGTCTTTTT
CCTTCATTGCCTGATTTGTTAACGGGGAGAGTCGAAGTCTCAACACCTGTTAATAGCTTCAAACGCCTGCAAGAA
GGCCTTTTCTTGTACACAAGAAATGTGTCGCCTTATGATGGTGGCGTCTTCCACCAGGCACCGCTCCTGTTACCT
CTGTTTGCCCTACTCCCGGATGCGAAGAGCTGGCCCTTGCCAACAGCAATTTTCTACTTCCTTGTCGACCTCATG
AACGCGTACGCATTGATGACTATATCTGCGTCGGGCCAGTCAGTCAAATCGAGACTACACTCAGCAGTCCGAAAA
CATGTTCGATGGGATGGAGTGTCCGTTGCAGCATGGTTCTTGTTCAATCCCCTTACTATTGCGACATGTTTAGCG
CGGTCAACCAGCGTATTTACGACATCCGGAATCCTCTTCGCCATCTCCAATGCAGTCGGCGGAAATAGCATCAAT
GCGATGCTAGCCCTTGGATTTGCTTCATACCTGTCTCTGTACCCGGCGCTGCTATTTATCCCGTTGGTCTTGCTA
TGCTATGACCGGCGGTTGGAGGGACCTAGCCCACCCAGTGCTGGATCGTTCATTATCCAACATGCTATCCTACTG
CTAGCCAGTGTGGCAGGCCTGCTTGGCCTATCCTGTCTGATCACCGGCAACTTTTGGGAGTTTATCTCGGCAACA
TATGGTTTCCATCTTTTGGTTCCAGACTTGACTCCGAACGTGGGGCTGTGGTGGTACTTTTTTATTGAGATGTTC
GACTCATTTCGAGAGTTCTTCCTCGGCGTTTTCTGGCTTCATTTGGCCAGCTATGTCGGGGGTCTCACTGCTCGC
TTCCGAAGTCAGCCATTATTCGTGATTACCTCGCTATTGGGTGTCTTCGCCGTGTTCAAGCCATACCCTAGCATC
TCAGATGCATCACTGTTCTTCGCATTGCTACCATTATATCGCCACCTTTTCCCATTGATGCGTTATACCTTCTTT
GCGGGCTCGGCAATCTTGTACTCCAGTCTTCTCGGTCCGGCTTTCTACCACCTTTGGATCTACGCAGGATCCGGA
AATGCCAATTTCTTCTACGCCATCACTCTAGTCTGGAGTTTGGGCCTCTCCATCCTCCTGGCCGACACCATCTTT
GCCGCTCTCAGAGACGAGTGGGAGCAAGAACACCCAGAGCAAGTGGGCACAGAGGTGCGACAGGTGTAG
Gene >Pro_DTO377G3_2|g6339.t1
ATGGCTGTAGACCGACGGAAGATTGCTGTATTTGGCGCAGCTTTCGTGCTGCGTCTGCTTCTTACATGTCTTTTT
CCTTCATTGCCTGATTTGTTAACGGGGAGAGTCGAAGTCTCAACACCTGTTAATAGCTTCAAACGCCGTACGTGT
CTCCGATTATTGACTCCGCATTCTGTAAACTAATTGCATGTAGTGCAAGAAGGCCTTTTCTTGTACACAAGAAAT
GTGTCGCCTTATGATGGTGGCGTCTTCCACCAGGTTCGTGGAACTAGATCCCTGCGACTCCGTTCCTTGAATTGA
CAATTTGATGATCTAGGCACCGCTCCTGTTACCTCTGTTTGCCCTACTCCCGGATGCGAAGAGCTGGCCCTTGCC
AACAGCAATTTTCTACTTCCTTGTCGACCTCATGAACGCGTACGCATTGATGACTATATCTGCGTCGGGCCAGTC
AGTCAAATCGAGACTACACTCAGCAGTCCGAAAACATGTTCGATGGGATGGAGTGTCCGTTGCAGCATGGTATAA
ATCTCTGGCTTCCCCATCATATGTATATCTACATGCTTACGACGGATAGGTTCTTGTTCAATCCCCTTACTATTG
CGACATGTTTAGCGCGGTCAACCAGCGTATTTACGACATCCGGAATCCTCTTCGCCATCTCCAATGCAGTCGGCG
GAAATAGCATCAATGCGATGCTAGCCCTTGGATTTGCTTCATACCTGTCTCTGTACCCGGCGCTGCTATTTATCC
CGTTGGTCTTGCTATGCTATGACCGGCGGTTGGAGGGACCTAGCCCACCCAGTGCTGGATCGTTCATTATCCAAC
ATGCTATCCTACTGCTAGCCAGTGTGGCAGGCCTGCTTGGCCTATCCTGTCTGATCACCGGCAACTTTTGGGAGT
TTATCTCGGCAACATATGGTTTCCATCTTTTGGTTCCAGACTTGACTCCGAACGTGGGGCTGTGGTGGTACTTTT
TTATTGAGATGTTCGACTCATTTCGAGAGTTCTTCCTCGGCGTTTTCTGGCTTCATTTGGCCAGCTATGTCGGGG
GTCTCACTGCTCGCTTCCGAAGTCAGCCATTATTCGTGATTACCTCGCTATTGGGTGTCTTCGCCGTGTTCAAGC
CATACCCTAGCATCTCAGATGCATCACTGTTCTTCGCATTGCTACCATTATATCGCCACCTTTTCCCATGTGAGT
ATTTCCAATAATTGAGCATATCTCAGGATCAACTTGACTAATTTGGTACAGTGATGCGTTATACCTTCTTTGCGG
GCTCGGCAATCTTGTACTCCAGTCTTCTCGGTCCGGCTTTCTACCACCTTTGGATCTACGCAGGATCCGGAAATG
CCAATTTCTTCTACGCCATCACTCTAGTCTGGAGTTTGGGCCTCTCCATCCTCCTGGCCGACACCATCTTTGCCG
CTCTCAGAGACGAGTGGGAGCAAGAACACCCAGAGCAAGTGGGCACAGAGGTGCGACAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail