Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6330.t1
Gene name
Locationscaffold_16:537075..537985
Strand+
Gene length (bp)910
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 91 113 22
2 128 150 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 36.09 17.49 54.70
5d_25C Five days - 25 degrees Celsius 37.46 18.33 56.59
7d_25C Seven days - 25 degrees Celsius 32.81 15.55 50.07
10d_25C Ten days - 25 degrees Celsius 24.48 10.67 38.28
7d_15C Seven days - 15 degrees Celsius 27.03 12.04 42.02
7d_30C Seven days - 30 degrees Celsius 28.55 13.00 44.09

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.932889 no
3d_25C 7d_25C 0.815551 no
3d_25C 7d_15C 0.397819 no
3d_25C 7d_30C 0.496197 no
3d_25C 10d_25C 0.217304 no
5d_25C 7d_25C 0.720186 no
5d_25C 7d_15C 0.303848 no
5d_25C 7d_30C 0.401423 no
5d_25C 10d_25C 0.154982 no
7d_25C 7d_15C 0.601532 no
7d_25C 7d_30C 0.719377 no
7d_25C 10d_25C 0.380044 no
7d_15C 7d_30C 0.907934 no
7d_15C 10d_25C 0.825761 no
7d_30C 10d_25C 0.699330 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6330.t1
MRLQILLHPQLRTTLPECAQRSLRRNVWVRFKSQIPRPSQKHLSPLPKSKETVPATRSPVTRTLTPPKTTTRTGP
PERILVYYGGTGRAIFLGTLRITTVLLFGAACLLVAPACSVADDYPWYSTPAVIAAGALPMIFVSYTAAPYVNFI
HLALPAFARKSREAAVQYAKDLPPTAVLYLTSMRFNTIPRQTAVRIGDLVPFKETLRPVTFQNLNPSPQRWWQGR
APTQFYTGTHSKPGRQTSAFYPELWNGIYEQIQKAKSQPR*
Coding >Pro_DTO377G3_2|g6330.t1
ATGCGACTTCAAATTTTACTTCACCCTCAATTACGCACAACTCTACCAGAGTGTGCCCAGCGCAGTCTTCGGAGG
AACGTCTGGGTTCGGTTCAAGTCACAGATCCCTCGGCCATCGCAGAAGCATCTTTCGCCATTACCCAAGTCGAAG
GAAACCGTCCCAGCTACGCGTTCTCCAGTAACAAGGACGCTCACACCGCCAAAGACAACCACCAGGACAGGACCA
CCTGAACGTATCTTAGTGTACTACGGAGGAACGGGTAGAGCTATCTTTCTGGGGACGCTACGAATCACCACGGTA
CTCCTATTTGGTGCAGCGTGTCTACTCGTTGCACCAGCATGCTCCGTGGCTGACGATTACCCCTGGTATAGCACA
CCTGCGGTGATTGCCGCTGGTGCCCTCCCGATGATATTTGTCTCCTATACTGCGGCGCCATATGTAAATTTCATC
CATCTGGCGTTGCCGGCCTTTGCGAGGAAGTCCCGTGAAGCTGCCGTCCAGTATGCAAAAGACCTGCCTCCGACG
GCCGTGCTGTATCTCACCAGCATGCGATTCAACACCATTCCTCGGCAAACAGCTGTTCGAATAGGAGACCTCGTT
CCATTTAAAGAGACCTTGCGGCCCGTCACATTCCAGAATCTGAATCCGTCGCCGCAACGATGGTGGCAGGGCAGA
GCTCCGACCCAGTTCTATACTGGAACTCACAGCAAACCCGGGAGACAAACATCGGCTTTCTACCCAGAATTGTGG
AATGGAATCTACGAGCAAATTCAGAAAGCCAAGTCGCAGCCTCGTTGA
Transcript >Pro_DTO377G3_2|g6330.t1
ATGCGACTTCAAATTTTACTTCACCCTCAATTACGCACAACTCTACCAGAGTGTGCCCAGCGCAGTCTTCGGAGG
AACGTCTGGGTTCGGTTCAAGTCACAGATCCCTCGGCCATCGCAGAAGCATCTTTCGCCATTACCCAAGTCGAAG
GAAACCGTCCCAGCTACGCGTTCTCCAGTAACAAGGACGCTCACACCGCCAAAGACAACCACCAGGACAGGACCA
CCTGAACGTATCTTAGTGTACTACGGAGGAACGGGTAGAGCTATCTTTCTGGGGACGCTACGAATCACCACGGTA
CTCCTATTTGGTGCAGCGTGTCTACTCGTTGCACCAGCATGCTCCGTGGCTGACGATTACCCCTGGTATAGCACA
CCTGCGGTGATTGCCGCTGGTGCCCTCCCGATGATATTTGTCTCCTATACTGCGGCGCCATATGTAAATTTCATC
CATCTGGCGTTGCCGGCCTTTGCGAGGAAGTCCCGTGAAGCTGCCGTCCAGTATGCAAAAGACCTGCCTCCGACG
GCCGTGCTGTATCTCACCAGCATGCGATTCAACACCATTCCTCGGCAAACAGCTGTTCGAATAGGAGACCTCGTT
CCATTTAAAGAGACCTTGCGGCCCGTCACATTCCAGAATCTGAATCCGTCGCCGCAACGATGGTGGCAGGGCAGA
GCTCCGACCCAGTTCTATACTGGAACTCACAGCAAACCCGGGAGACAAACATCGGCTTTCTACCCAGAATTGTGG
AATGGAATCTACGAGCAAATTCAGAAAGCCAAGTCGCAGCCTCGTTGA
Gene >Pro_DTO377G3_2|g6330.t1
ATGCGACTTCAAATTTTACTTCACCCTCAATTACGCACAACTCTACCAGAGTGTGCCCAGCGCAGTCTTCGGAGG
AACGTCTGGGTTCGGTTCAAGTCACAGATCCCTCGGCCATCGCAGAAGCATCTTTCGCCATTACCCAAGTCGAAG
GAAACCGTCCCAGCTACGCGTTCTCCAGTAACAAGGACGCTCACACCGCCAAAGACAACCACCAGGACAGGTACC
GTGAACCCTCCCGGCCAGTTGTTAGACGTGCGTGTGCTGAGCTATAGTTACAGGACCACCTGAACGTATCTTAGT
GTACTACGGAGGAACGGGTAGAGCTATCTTTCTGGGGACGCTACGAATCACCACGGTACTCCTATTTGGTGCAGC
GTGTCTACTCGTTGCACCAGCATGCTCCGTGGCTGACGATTACCCCTGGTATAGCACACCTGCGGGTAAGCTAAT
TGAACATCCACATCGCCTGAGCGTCTATGCTGATTTTACCTCAGTGATTGCCGCTGGTGCCCTCCCGATGATATT
TGTCTCCTATACTGCGGCGCCATATGTAAATTTCATCCATCTGGCGTTGCCGGCCTTTGCGAGGAAGTCCCGTGA
AGCTGCCGTCCAGTATGCAAAAGACCTGCCTCCGACGGCCGTGCTGTATCTCACCAGCATGCGATTCAACACCAT
TCCTCGGCAAACAGCTGTTCGAATAGGAGACCTCGTTCCATTTAAAGAGACCTTGCGGCCCGTCACATTCCAGAA
TCTGAATCCGTCGCCGCAACGATGGTGGCAGGGCAGAGCTCCGACCCAGTTCTATACTGGAACTCACAGCAAACC
CGGGAGACAAACATCGGCTTTCTACCCAGAATTGTGGAATGGAATCTACGAGCAAATTCAGAAAGCCAAGTCGCA
GCCTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail