Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6313.t1
Gene name
Locationscaffold_16:495287..499756
Strand+
Gene length (bp)4469
Transcript length (bp)3237
Coding sequence length (bp)3237
Protein length (aa) 1079

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11815 DUF3336 Domain of unknown function (DUF3336) 7.0E-36 369 486
PF03006 HlyIII Haemolysin-III related 8.9E-33 71 277
PF01734 Patatin Patatin-like phospholipase 1.7E-21 517 705

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0016021 integral component of membrane Yes
GO:0004806 triglyceride lipase activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016298 lipase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0110165 cellular anatomical entity No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 113 135 22
3 150 172 22
4 179 201 22
5 211 233 22
6 240 262 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 32.85 19.97 45.73
5d_25C Five days - 25 degrees Celsius 39.88 24.30 55.46
7d_25C Seven days - 25 degrees Celsius 42.51 25.90 59.12
10d_25C Ten days - 25 degrees Celsius 54.36 33.07 75.65
7d_15C Seven days - 15 degrees Celsius 50.30 30.29 70.31
7d_30C Seven days - 30 degrees Celsius 39.77 24.44 55.10

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.440632 no
3d_25C 7d_25C 0.274534 no
3d_25C 7d_15C 0.048064 yes
3d_25C 7d_30C 0.440026 no
3d_25C 10d_25C 0.017204 yes
5d_25C 7d_25C 0.836827 no
5d_25C 7d_15C 0.330124 no
5d_25C 7d_30C 0.993328 no
5d_25C 10d_25C 0.158622 no
7d_25C 7d_15C 0.517162 no
7d_25C 7d_30C 0.830579 no
7d_25C 10d_25C 0.290868 no
7d_15C 7d_30C 0.320184 no
7d_15C 10d_25C 0.800009 no
7d_30C 10d_25C 0.148751 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6313.t1
MSSLRLAMTSLLTGLRPEVVEKLQSDKTGFPQKQHVFHASDVPKWMQWDPFIQRGYRTQLNSFKRCFWSLFYLHN
ESINTWSHVLAGIYFLAVLLATDYWIAQLGLKVPLSDILAIQTYVAGTAGCLIFSATFHATNAHSPEVAHAFLKL
DYFGIVLTISTTCISVAYFALHGEPRLQCVYIFFTVLCAAMVFCITLDVGMDGTRAGPWRATVFTLLAASGLAPI
FHVISSGSPRDFIRIPWETLIVTCSSYAIGTVAYLFRFPERYWPAQFDIIISAFHTPAEWLASLMHRPTMSVLGD
PTLVQCHHGRKHSQEYSLPQPLPPRPLCKTISIPTVSSLVKDSWNWAGDTLHTYRDGLSKEQRKQRADIEDRKQV
LYLKIKNAVSYEEWRSCASELDELEDNNAWKQTLECTEYDPRLVQDRLRQLEEARISCDVSRMLFLVRTALSRDL
AHMSNASLYRHSHIGTKDLIDRYITTALDTIATLVDLSVHDRCDGLELKYILDQLLAARQAFGRSALLFSGGATF
GMTHIGVLKALYEAKMIPRIISGASAGSIVCAVFCTRTDEELPALLDTYVHGDFDVFNEKGQEENILQKMTRFLK
FGSFFDISHLAKTIRNWLGDMTFQEAYNRTRRILNICVSSAGMYELPRLLNYISAPNVLIWSAVAVSCSVPFVFR
PFTLMAKDPLTGEPVPWNDLHKQYIDGSVDGDLPMTRLSEMFNVNHFIVSQVNPHVVPFLPKETGPQDATNDGPS
FIPRWMNMMAHLAKDEVLHRMNVLSELGVFPTSMTKFASIVNQKYHGDINIYPELLSSNLPRLLENPTTEFMLSS
CLSGERATWPRLSRIRNHCAIELALDNAIQNMRARVAFSPSQVDLRMPHRSRHSIDSADSNGRGRYRDRRRGSHS
PEFEKRQSGGQELRRPDHELRKERSTVSLENPPLSQSSESIFMPTQTRTHRRTSSVFFSNGGMFDIGSSSDDELE
RSYMLRPKLAGHRTFSESSSFGRVAPSHGPRSPVRSRRSSLSSNPAYNFSSTARRSSPKQVYTPSARDFSVTIPP
SSRHLLSMTPTPTLLPSSPEPLTRKRQN*
Coding >Pro_DTO377G3_2|g6313.t1
ATGTCTTCTCTCCGTCTAGCAATGACCAGTCTGTTAACCGGGTTGCGCCCAGAGGTGGTGGAAAAACTTCAGTCG
GACAAGACTGGCTTTCCTCAAAAGCAACATGTCTTCCATGCATCCGACGTTCCTAAATGGATGCAATGGGACCCG
TTTATCCAACGAGGATACCGAACCCAGCTGAATAGTTTCAAGCGGTGTTTCTGGTCCCTATTCTATCTACATAAT
GAATCAATCAACACCTGGTCACACGTCCTTGCAGGAATTTATTTCCTCGCCGTTCTTCTCGCCACCGACTATTGG
ATCGCCCAACTGGGACTCAAAGTGCCATTATCAGACATACTTGCTATTCAGACGTATGTTGCCGGCACTGCAGGG
TGTCTCATATTCTCCGCTACCTTCCACGCAACCAACGCTCATTCGCCTGAAGTCGCTCATGCCTTCCTCAAACTA
GATTACTTCGGAATTGTGCTCACCATCTCAACTACATGTATCTCAGTCGCTTATTTCGCCCTGCACGGAGAACCG
AGGCTCCAATGCGTCTACATTTTCTTCACTGTTCTCTGCGCAGCTATGGTCTTCTGTATCACACTTGATGTCGGT
ATGGATGGTACACGTGCTGGTCCATGGAGAGCAACTGTATTCACCCTTCTTGCGGCTAGCGGCCTAGCCCCTATC
TTCCACGTCATCTCGAGCGGTTCCCCTCGCGATTTCATCCGCATCCCTTGGGAGACTCTCATAGTAACCTGTTCT
TCATACGCAATTGGCACAGTGGCGTATCTCTTCCGGTTTCCAGAGCGGTATTGGCCGGCGCAATTTGATATTATC
ATCTCCGCATTTCACACCCCGGCTGAATGGCTTGCTTCTCTAATGCACAGGCCTACCATGTCGGTGTTGGGCGAC
CCCACATTAGTTCAGTGCCATCATGGGCGCAAACACTCCCAAGAATACTCTTTACCCCAACCCTTACCTCCGCGA
CCGCTCTGCAAAACGATCTCCATCCCAACCGTATCGTCGCTCGTGAAGGATTCGTGGAATTGGGCCGGTGATACT
CTGCACACCTACCGTGATGGTCTCTCGAAGGAACAACGGAAACAAAGGGCGGACATCGAGGACCGCAAGCAAGTC
CTGTATCTGAAAATAAAGAATGCTGTGTCGTACGAAGAATGGCGAAGTTGCGCCAGTGAACTGGACGAACTAGAG
GATAACAACGCTTGGAAGCAGACACTCGAGTGCACCGAATATGATCCTCGTTTGGTACAGGATCGTTTGCGACAG
TTGGAAGAGGCTCGCATCAGCTGTGATGTAAGCCGGATGTTGTTCTTGGTGCGTACTGCGCTGAGTCGGGACCTG
GCGCATATGAGCAATGCCTCTCTCTATCGCCATTCGCATATTGGTACAAAGGACTTGATCGATAGGTATATCACC
ACGGCTTTGGATACTATCGCTACGCTGGTGGATCTCTCGGTGCATGATCGCTGTGATGGGTTGGAGCTGAAGTAT
ATCCTGGACCAGCTCCTGGCAGCTCGACAGGCATTTGGTCGCAGTGCTCTCCTTTTCTCCGGTGGTGCCACTTTT
GGCATGACCCATATCGGGGTTCTCAAGGCCCTCTATGAAGCAAAAATGATTCCGCGAATTATCTCAGGTGCCTCG
GCTGGTAGCATTGTGTGCGCGGTATTTTGCACGCGCACAGACGAAGAGCTTCCGGCGCTTTTGGATACCTATGTA
CATGGGGATTTCGACGTTTTCAATGAAAAGGGCCAAGAGGAAAATATCTTGCAGAAGATGACTCGTTTTTTGAAG
TTTGGATCATTTTTTGACATATCTCACTTGGCGAAGACTATCAGAAACTGGCTGGGGGATATGACTTTTCAGGAA
GCATATAACCGCACCCGCAGAATCCTAAATATCTGTGTGTCAAGTGCCGGCATGTATGAGCTTCCACGGCTGTTG
AACTATATTTCTGCTCCCAATGTGTTGATCTGGTCTGCTGTCGCGGTATCATGCTCTGTTCCTTTTGTCTTTAGG
CCATTCACGTTGATGGCTAAAGATCCGTTGACAGGGGAACCGGTCCCCTGGAATGATCTTCACAAGCAGTATATT
GATGGCTCGGTCGATGGAGATTTACCCATGACACGCTTATCGGAGATGTTTAACGTGAATCACTTTATAGTCTCC
CAAGTGAACCCCCATGTGGTTCCATTTCTTCCAAAGGAAACAGGCCCACAGGATGCGACAAACGACGGCCCTTCG
TTCATTCCTCGATGGATGAACATGATGGCGCACCTTGCCAAAGACGAGGTTCTGCATCGGATGAACGTCCTCTCA
GAACTTGGAGTCTTTCCAACATCAATGACCAAGTTTGCCTCTATTGTGAACCAGAAATATCATGGAGACATCAAC
ATATACCCAGAACTCCTTTCCTCTAACCTCCCAAGGCTCCTGGAGAATCCCACAACGGAGTTCATGCTTTCGTCA
TGCCTGAGTGGCGAGCGGGCGACATGGCCGAGACTAAGCCGTATCCGAAACCACTGCGCCATTGAGCTGGCACTC
GATAATGCAATTCAAAATATGCGGGCCCGGGTGGCCTTCAGTCCAAGTCAGGTTGATCTACGTATGCCGCACCGT
AGTCGTCACTCGATTGACTCGGCAGACAGCAACGGAAGGGGACGTTATCGGGACAGGCGAAGAGGGTCCCACAGC
CCCGAATTTGAAAAGAGGCAGTCGGGTGGGCAGGAACTACGTCGGCCAGATCACGAACTGAGAAAGGAACGAAGC
ACTGTTTCGTTAGAGAACCCGCCTCTCTCGCAATCAAGCGAGTCAATCTTCATGCCAACCCAAACAAGGACCCAC
CGCCGTACATCCTCAGTATTCTTCAGCAATGGAGGGATGTTCGATATTGGGTCAAGCAGCGATGACGAGCTCGAA
CGATCATACATGCTTCGTCCCAAACTCGCAGGCCACCGAACGTTCTCAGAGTCATCTTCGTTTGGCAGAGTAGCT
CCGAGTCACGGGCCCCGCAGCCCTGTCCGGTCCCGACGATCATCATTATCCTCTAACCCGGCCTATAATTTCTCC
TCCACGGCTCGTCGCAGTTCCCCAAAGCAGGTTTATACGCCGTCGGCTCGCGATTTCTCCGTGACCATACCACCT
TCATCCCGCCATCTGCTCAGTATGACTCCAACGCCAACACTCCTTCCGAGCTCGCCTGAGCCCCTCACGCGCAAG
CGGCAGAATTGA
Transcript >Pro_DTO377G3_2|g6313.t1
ATGTCTTCTCTCCGTCTAGCAATGACCAGTCTGTTAACCGGGTTGCGCCCAGAGGTGGTGGAAAAACTTCAGTCG
GACAAGACTGGCTTTCCTCAAAAGCAACATGTCTTCCATGCATCCGACGTTCCTAAATGGATGCAATGGGACCCG
TTTATCCAACGAGGATACCGAACCCAGCTGAATAGTTTCAAGCGGTGTTTCTGGTCCCTATTCTATCTACATAAT
GAATCAATCAACACCTGGTCACACGTCCTTGCAGGAATTTATTTCCTCGCCGTTCTTCTCGCCACCGACTATTGG
ATCGCCCAACTGGGACTCAAAGTGCCATTATCAGACATACTTGCTATTCAGACGTATGTTGCCGGCACTGCAGGG
TGTCTCATATTCTCCGCTACCTTCCACGCAACCAACGCTCATTCGCCTGAAGTCGCTCATGCCTTCCTCAAACTA
GATTACTTCGGAATTGTGCTCACCATCTCAACTACATGTATCTCAGTCGCTTATTTCGCCCTGCACGGAGAACCG
AGGCTCCAATGCGTCTACATTTTCTTCACTGTTCTCTGCGCAGCTATGGTCTTCTGTATCACACTTGATGTCGGT
ATGGATGGTACACGTGCTGGTCCATGGAGAGCAACTGTATTCACCCTTCTTGCGGCTAGCGGCCTAGCCCCTATC
TTCCACGTCATCTCGAGCGGTTCCCCTCGCGATTTCATCCGCATCCCTTGGGAGACTCTCATAGTAACCTGTTCT
TCATACGCAATTGGCACAGTGGCGTATCTCTTCCGGTTTCCAGAGCGGTATTGGCCGGCGCAATTTGATATTATC
ATCTCCGCATTTCACACCCCGGCTGAATGGCTTGCTTCTCTAATGCACAGGCCTACCATGTCGGTGTTGGGCGAC
CCCACATTAGTTCAGTGCCATCATGGGCGCAAACACTCCCAAGAATACTCTTTACCCCAACCCTTACCTCCGCGA
CCGCTCTGCAAAACGATCTCCATCCCAACCGTATCGTCGCTCGTGAAGGATTCGTGGAATTGGGCCGGTGATACT
CTGCACACCTACCGTGATGGTCTCTCGAAGGAACAACGGAAACAAAGGGCGGACATCGAGGACCGCAAGCAAGTC
CTGTATCTGAAAATAAAGAATGCTGTGTCGTACGAAGAATGGCGAAGTTGCGCCAGTGAACTGGACGAACTAGAG
GATAACAACGCTTGGAAGCAGACACTCGAGTGCACCGAATATGATCCTCGTTTGGTACAGGATCGTTTGCGACAG
TTGGAAGAGGCTCGCATCAGCTGTGATGTAAGCCGGATGTTGTTCTTGGTGCGTACTGCGCTGAGTCGGGACCTG
GCGCATATGAGCAATGCCTCTCTCTATCGCCATTCGCATATTGGTACAAAGGACTTGATCGATAGGTATATCACC
ACGGCTTTGGATACTATCGCTACGCTGGTGGATCTCTCGGTGCATGATCGCTGTGATGGGTTGGAGCTGAAGTAT
ATCCTGGACCAGCTCCTGGCAGCTCGACAGGCATTTGGTCGCAGTGCTCTCCTTTTCTCCGGTGGTGCCACTTTT
GGCATGACCCATATCGGGGTTCTCAAGGCCCTCTATGAAGCAAAAATGATTCCGCGAATTATCTCAGGTGCCTCG
GCTGGTAGCATTGTGTGCGCGGTATTTTGCACGCGCACAGACGAAGAGCTTCCGGCGCTTTTGGATACCTATGTA
CATGGGGATTTCGACGTTTTCAATGAAAAGGGCCAAGAGGAAAATATCTTGCAGAAGATGACTCGTTTTTTGAAG
TTTGGATCATTTTTTGACATATCTCACTTGGCGAAGACTATCAGAAACTGGCTGGGGGATATGACTTTTCAGGAA
GCATATAACCGCACCCGCAGAATCCTAAATATCTGTGTGTCAAGTGCCGGCATGTATGAGCTTCCACGGCTGTTG
AACTATATTTCTGCTCCCAATGTGTTGATCTGGTCTGCTGTCGCGGTATCATGCTCTGTTCCTTTTGTCTTTAGG
CCATTCACGTTGATGGCTAAAGATCCGTTGACAGGGGAACCGGTCCCCTGGAATGATCTTCACAAGCAGTATATT
GATGGCTCGGTCGATGGAGATTTACCCATGACACGCTTATCGGAGATGTTTAACGTGAATCACTTTATAGTCTCC
CAAGTGAACCCCCATGTGGTTCCATTTCTTCCAAAGGAAACAGGCCCACAGGATGCGACAAACGACGGCCCTTCG
TTCATTCCTCGATGGATGAACATGATGGCGCACCTTGCCAAAGACGAGGTTCTGCATCGGATGAACGTCCTCTCA
GAACTTGGAGTCTTTCCAACATCAATGACCAAGTTTGCCTCTATTGTGAACCAGAAATATCATGGAGACATCAAC
ATATACCCAGAACTCCTTTCCTCTAACCTCCCAAGGCTCCTGGAGAATCCCACAACGGAGTTCATGCTTTCGTCA
TGCCTGAGTGGCGAGCGGGCGACATGGCCGAGACTAAGCCGTATCCGAAACCACTGCGCCATTGAGCTGGCACTC
GATAATGCAATTCAAAATATGCGGGCCCGGGTGGCCTTCAGTCCAAGTCAGGTTGATCTACGTATGCCGCACCGT
AGTCGTCACTCGATTGACTCGGCAGACAGCAACGGAAGGGGACGTTATCGGGACAGGCGAAGAGGGTCCCACAGC
CCCGAATTTGAAAAGAGGCAGTCGGGTGGGCAGGAACTACGTCGGCCAGATCACGAACTGAGAAAGGAACGAAGC
ACTGTTTCGTTAGAGAACCCGCCTCTCTCGCAATCAAGCGAGTCAATCTTCATGCCAACCCAAACAAGGACCCAC
CGCCGTACATCCTCAGTATTCTTCAGCAATGGAGGGATGTTCGATATTGGGTCAAGCAGCGATGACGAGCTCGAA
CGATCATACATGCTTCGTCCCAAACTCGCAGGCCACCGAACGTTCTCAGAGTCATCTTCGTTTGGCAGAGTAGCT
CCGAGTCACGGGCCCCGCAGCCCTGTCCGGTCCCGACGATCATCATTATCCTCTAACCCGGCCTATAATTTCTCC
TCCACGGCTCGTCGCAGTTCCCCAAAGCAGGTTTATACGCCGTCGGCTCGCGATTTCTCCGTGACCATACCACCT
TCATCCCGCCATCTGCTCAGTATGACTCCAACGCCAACACTCCTTCCGAGCTCGCCTGAGCCCCTCACGCGCAAG
CGGCAGAATTGA
Gene >Pro_DTO377G3_2|g6313.t1
ATGTCTTCTCTCCGTCTAGCAATGACCAGTCTGTTAACCGGGTTGCGCCCAGAGGTGGTGGAAAAACTTCAGTCG
GACAAGACTGGCTTTCCTCAAAAGCAACATGTCTTCCATGCATCCGACGTTCCTAAATGGATGCAATGGGACCCG
TTTATCCAACGAGGATACCGAACCCAGCTGAATAGTTTCAAGCGGTGTTTCTGGTCCCTATTCTATCTACATAAT
GAATCAATCAACACCTGGTCACACGTCCTTGCAGGAATTTATTTCCTCGCCGTTCTTCTCGCCACCGACTATTGG
ATCGCCCAACTGGGACTCAAAGTGCCATTATCAGACATACTTGCTATTCAGACGTATGTTGCCGGCACTGCAGGG
TGTCTCATATTCTCCGTCAGTCTCTCCGTTAATCAATCCTTTTTACAAAATCCAGAAGTACTTAACTGATCCTCA
CAATTCTAGGCTACCTTCCACGCAACCAACGCTCATTCGCCTGAAGTCGCTCATGCCTTCCTCAAACTAGATTAC
TTCGGAATTGTGCTCACCATCTCAACTACATGTATCTCAGTCGCTTATTTCGCCCTGCACGGAGAACCGAGGCTC
CAATGCGTCTACATTTTCTTCACTGTTCTCTGCGCAGCTATGGTCTTCTGTATCACACTTGATGTCGGTATGGAT
GGTACACGTGCTGGTCCATGGAGGTAAGCTCTAGCATAATATCTTCTCATGTGTTATTGCAGCATTTCAGTTCAA
TAACACCTGTTCTTTCCTCACACAGAGCAACTGTATTCACCCTTCTTGCGGCTAGCGGCCTAGCCCCTATCTTCC
ACGTCATCTCGAGCGGTTCCCCTCGCGATTTCATCCGCATCCCTTGGGAGACTCTCATAGTAACCTGTTCTTCAT
ACGCAATTGGCACAGTGGCGTATCTCTTCCGGTTTCCAGAGCGGTATTGGCCGGCGCAATTTGATATTATCGTGA
GTCTGATTCATGTTCATAACGGAAAGAGGATGGTTTGGGACTAATGAGAAATATAGGGTGCTAGCCATCAGATAT
TCCATATTTTGGTTGCGTTTGGCCAGGTTGTGCATCTGTTCGGACTTCGGGATGTGCTTGTAGGAATCCACCTAG
AGTCGCATACGGTGTAGGCACTCAGTAGTACCGTACCATACGTCTCAATGAAGAGAAAGTGTGTTTTAAAATGAG
GTGGCAGTGAAGAGCTTTGGTAGAATGCAATAATTCAGGAAAACGAACGAGTTCTATAAGGCCAACCCGGATCAG
AAAAGGATGCTGTTCATGTCACGGATAGTTAGCCAGATGGAAATCAAATGATTCGGGCATGGCAATTTCAACTAT
CAGTCGGGCCTGTCAAACTTCATGCATTCCAGCTAACTAAATCAATCCATCGCACAAATGTCATCAATAGTGTCC
ACGCTTTGGGCAAGATTCACGAGGTCAGGTGCCCAGATGAGCACCTGACCTGTATTCAACTTACGTAATTATCAG
GTGATCTGGGTGTTTACCTGATTATGTAAGACTCAGGGCGTGCTCAATTTTACTCAGGGGAGCAAAAGCGGCAAG
GAATAAGCACTAAAACGCAAAGGGAAAGGTGATGACCATGCAGCAATGCTTCCCCACTGTCCGAGATGAGGTTGA
TCGTGGGGTGAGATCATGTCTTCTGATACTATCGGTTATAGAAGAAATATTGTATATCGCACATCTTTTCCTAGA
GTAGTAAAATAGTGTATGGCATGTGATAGTGAAATCGTCATAAAAGGAACCAAGTGGCTCAAAGGGCCCGAAGAA
AATGGCTACCATTGGCCCTCGTGACGTTTGTTAGGTCACCGCCAAACTTGACTTGAATCCGGGGAATCTCTACTT
TTATAACTCGTTTACTGGTTTCGTTTTTATTATAATACTTTCATTCCGGAGCTAACAGATCTCCGCATTTCACAC
CCCGGCTGAATGGCTTGCTTCTCTAATGCACAGGCCTACCATGTCGGTGTTGGGCGACCCCACATTAGTTCAGTG
CCATCATGGGCGCAAACACTCCCAAGAATACTCTTTACCCCAACCCTTACCTCCGCGACCGCTCTGCAAAACGAT
CTCCATCCCAACCGTATCGTCGCTCGTGAAGGATTCGTGGAATTGGGCCGGTGATACTCTGCACACCTACCGTGA
TGGTCTCTCGAAGGAACAACGGAAACAAAGGGCGGACATCGAGGACCGCAAGCAAGTCCTGTATCTGAAAATAAA
GAATGTATGTACATGCGGTGTACCTGGGCCGAGCGATCGCATCTGCAGGGTGACCCCTTTCTAACCCTTGGGCTG
CAGGCTGTGTCGTACGAAGAATGGCGAAGTTGCGCCAGTGAACTGGACGAACTAGAGGATAACAACGCTTGGAAG
CAGACACTCGAGTGCACCGAATATGATCCTCGTTTGGTACAGGATCGTTTGCGACAGTTGGAAGAGGCTCGCATC
AGCTGTGATGTAAGCCGGATGTTGTTCTTGGTGCGTACTGCGCTGAGTCGGGACCTGGCGCATATGAGCAATGCC
TCTCTCTATCGCCATTCGCATATTGGTACAAAGGACTTGATCGATAGGTATATCACCACGGCTTTGGATACTATC
GCTACGCTGGTGGATCTCTCGGTGCATGATCGCTGTGATGGGTTGGAGCTGAAGTATATCCTGGACCAGCTCCTG
GCAGCTCGACAGGCATTTGGTCGCAGTGCTCTCCTTTTCTCCGGTGGTGCCACTTTTGGCATGACCCATATCGGG
GTTCTCAAGGCCCTCTATGAAGCAAAAATGATTCCGCGAATTATCTCAGGTGCCTCGGCTGGTAGCATTGTGTGC
GCGGTATTTTGCACGCGCACAGACGAAGAGCTTCCGGCGCTTTTGGATACCTATGTACATGGGGATTTCGACGTT
TTCAATGAAAAGGGCCAAGAGGAAAATATCTTGCAGAAGATGACTCGTTTTTTGAAGTTTGGATCATTTTTTGAC
ATATCTCACTTGGCGAAGACTATCAGAAACTGGCTGGGGGATATGACTTTTCAGGAAGCATATAACCGCACCCGC
AGAATCCTAAATATCTGTGTGTCAAGTGCCGGCATGTATGAGCTTCCACGGCTGTTGAACTATATTTCTGCTCCC
AATGTGTTGATCTGGTCTGCTGTGTAAGTTCCTCCTTTTTCACATCATCAACCCATTTCTAACGTCTTTCAAGCG
CGGTATCATGCTCTGTTCCTTTTGTCTTTAGGCCATTCACGTTGATGGCTAAAGATCCGTTGACAGGGGAACCGG
TCCCCTGGAATGATCTTCACAAGCAGTATATTGATGGCTCGGTCGATGGAGATTTACCCATGACACGCTTATCGG
AGATGTTTAACGTGAATCACTTTATAGTCTCCCAAGTGAACCCCCATGTGGTTCCATTTCTTCCAAAGGAAACAG
GCCCACAGGATGCGACAAACGACGGCCCTTCGTTCATTCCTCGATGGATGAACATGATGGCGCACCTTGCCAAAG
ACGAGGTTCTGCATCGGATGAACGTCCTCTCAGAACTTGGAGTCTTTCCAACATCAATGACCAAGTTTGCCTCTA
TTGTGAACCAGAAATATCATGGAGACATCAACATATACCCAGAACTCCTTTCCTCTAACCTCCCAAGGCTCCTGG
AGAATCCCACAACGGAGTTCATGCTTTCGTCATGCCTGAGTGGCGAGCGGGCGACATGGCCGAGACTAAGCCGTA
TCCGAAACCACTGCGCCATTGAGCTGGCACTCGATAATGCAATTCAAAATATGCGGGCCCGGGTGGCCTTCAGTC
CAAGTCAGGTTGATCTACGTATGCCGCACCGTAGTCGTCACTCGATTGACTCGGCAGACAGCAACGGAAGGGGAC
GTTATCGGGACAGGCGAAGAGGGTCCCACAGCCCCGAATTTGAAAAGAGGCAGTCGGGTGGGCAGGAACTACGTC
GGCCAGATCACGAACTGAGAAAGGAACGAAGCACTGTTTCGTTAGAGAACCCGCCTCTCTCGCAATCAAGCGAGT
CAATCTTCATGCCAACCCAAACAAGGACCCACCGCCGTACATCCTCAGTATTCTTCAGCAATGGAGGGATGTTCG
ATATTGGGTCAAGCAGCGATGACGAGCTCGAACGATCATACATGCTTCGTCCCAAACTCGCAGGCCACCGAACGT
TCTCAGAGTCATCTTCGTTTGGCAGAGTAGCTCCGAGTCACGGGCCCCGCAGCCCTGTCCGGTCCCGACGATCAT
CATTATCCTCTAACCCGGCCTATAATTTCTCCTCCACGGCTCGTCGCAGTTCCCCAAAGCAGGTTTATACGCCGT
CGGCTCGCGATTTCTCCGTGACCATACCACCTTCATCCCGCCATCTGCTCAGTATGACTCCAACGCCAACACTCC
TTCCGAGCTCGCCTGAGCCCCTCACGCGCAAGCGGCAGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail