Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6280.t1
Gene name
Locationscaffold_16:406341..407815
Strand-
Gene length (bp)1474
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.0E-51 59 453

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 92 114 22
3 135 157 22
4 167 189 22
5 196 218 22
6 247 269 22
7 281 303 22
8 323 345 22
9 365 383 18
10 393 415 22
11 435 457 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6280.t1
MADERGYGSFHPGDNGPSPVMGCASPQPQADENTKLLSNDGDAGFEDQRVIEGHANFHRLGWKRLTVVSIVEAIA
LGALSLPQAFAVLGMIPGIVICVGMGIVAIYTSYIIGAVKIKFPSVAHYGDIGQLMMGSFGYWLFSVIFVFQLTL
SVGSHCLTGMIAFANITESTICALVFGGISAVILLLLAIPPTFADVAILGYVDFVSIILAIGVTMVGTGIQQAQM
PGGLASSDWSYWPAEDVTFPKAAVAISNIVFAYAFAGALPSFMNEMHTPKDYVKSITALGVIEISIYVLTGSIIY
AFVGQDVQSPALLSAGPVMSKIAFGIALPVIFISGSINTTVVCRFIHTRIYRDSVVQYVNTVKGWVTWLALVVAV
TLIAWIVAESIPFFSELMAISAALLVSGMSFYFPPVMWLLLLKDGNWHDRKNVWHAVCNLVCFLIGIAVLGGGVY
ASIFELIRKFQDGNMGKPFSCSI*
Coding >Pro_DTO377G3_2|g6280.t1
ATGGCCGACGAGAGGGGTTACGGCTCTTTCCACCCCGGCGATAACGGTCCTTCGCCCGTGATGGGCTGTGCCAGC
CCACAACCACAAGCCGATGAAAACACCAAGTTGTTATCAAATGACGGTGATGCTGGGTTCGAGGACCAAAGGGTG
ATCGAGGGACATGCTAACTTCCATCGACTCGGGTGGAAGCGTCTCACTGTGGTCAGCATCGTCGAAGCGATCGCT
CTCGGCGCACTGAGTCTCCCCCAGGCATTTGCCGTTCTAGGGATGATCCCCGGTATAGTCATATGCGTTGGCATG
GGAATTGTTGCCATTTATACCAGTTACATCATCGGAGCAGTCAAGATAAAATTCCCTTCGGTTGCCCACTATGGA
GACATTGGGCAGCTGATGATGGGGAGCTTTGGCTACTGGCTGTTCAGTGTAATATTCGTCTTTCAACTGACACTC
TCTGTTGGATCCCACTGCCTTACGGGCATGATCGCCTTTGCAAATATTACTGAGAGTACAATTTGCGCTCTAGTA
TTTGGTGGTATCTCCGCTGTCATTCTACTCTTATTGGCGATACCGCCAACATTCGCCGATGTTGCAATCCTAGGC
TATGTTGACTTCGTTTCTATCATTCTGGCAATCGGAGTCACCATGGTCGGCACTGGAATCCAACAGGCTCAGATG
CCCGGTGGATTAGCGAGTTCAGACTGGTCTTACTGGCCGGCCGAGGATGTCACGTTCCCTAAAGCAGCGGTTGCT
ATCAGCAACATCGTCTTTGCCTACGCCTTTGCTGGTGCTTTGCCGTCATTCATGAACGAAATGCATACGCCGAAA
GACTATGTCAAATCGATAACTGCACTCGGCGTCATCGAAATCTCAATCTATGTGCTCACCGGGTCTATCATCTAT
GCATTTGTCGGACAGGATGTTCAATCCCCAGCTCTGCTGTCCGCGGGGCCTGTGATGTCCAAAATCGCGTTTGGA
ATCGCCCTCCCCGTGATCTTCATTTCTGGCTCTATCAATACAACGGTCGTATGTCGGTTCATCCATACGCGGATT
TATCGCGATTCGGTGGTTCAATACGTCAACACGGTGAAGGGATGGGTCACCTGGCTGGCGCTCGTGGTTGCCGTC
ACCCTGATCGCTTGGATAGTTGCCGAAAGTATCCCCTTCTTTTCCGAGCTCATGGCTATCAGTGCGGCTCTGCTC
GTCTCCGGGATGTCTTTCTATTTCCCTCCTGTGATGTGGCTTTTACTTCTGAAAGACGGGAATTGGCATGACCGG
AAAAATGTCTGGCATGCTGTGTGCAATCTGGTCTGTTTCCTAATCGGAATCGCAGTCCTCGGAGGTGGAGTTTAT
GCAAGTATCTTCGAATTGATCAGGAAATTCCAGGATGGGAATATGGGGAAACCTTTTTCGTGCTCGATATAA
Transcript >Pro_DTO377G3_2|g6280.t1
ATGGCCGACGAGAGGGGTTACGGCTCTTTCCACCCCGGCGATAACGGTCCTTCGCCCGTGATGGGCTGTGCCAGC
CCACAACCACAAGCCGATGAAAACACCAAGTTGTTATCAAATGACGGTGATGCTGGGTTCGAGGACCAAAGGGTG
ATCGAGGGACATGCTAACTTCCATCGACTCGGGTGGAAGCGTCTCACTGTGGTCAGCATCGTCGAAGCGATCGCT
CTCGGCGCACTGAGTCTCCCCCAGGCATTTGCCGTTCTAGGGATGATCCCCGGTATAGTCATATGCGTTGGCATG
GGAATTGTTGCCATTTATACCAGTTACATCATCGGAGCAGTCAAGATAAAATTCCCTTCGGTTGCCCACTATGGA
GACATTGGGCAGCTGATGATGGGGAGCTTTGGCTACTGGCTGTTCAGTGTAATATTCGTCTTTCAACTGACACTC
TCTGTTGGATCCCACTGCCTTACGGGCATGATCGCCTTTGCAAATATTACTGAGAGTACAATTTGCGCTCTAGTA
TTTGGTGGTATCTCCGCTGTCATTCTACTCTTATTGGCGATACCGCCAACATTCGCCGATGTTGCAATCCTAGGC
TATGTTGACTTCGTTTCTATCATTCTGGCAATCGGAGTCACCATGGTCGGCACTGGAATCCAACAGGCTCAGATG
CCCGGTGGATTAGCGAGTTCAGACTGGTCTTACTGGCCGGCCGAGGATGTCACGTTCCCTAAAGCAGCGGTTGCT
ATCAGCAACATCGTCTTTGCCTACGCCTTTGCTGGTGCTTTGCCGTCATTCATGAACGAAATGCATACGCCGAAA
GACTATGTCAAATCGATAACTGCACTCGGCGTCATCGAAATCTCAATCTATGTGCTCACCGGGTCTATCATCTAT
GCATTTGTCGGACAGGATGTTCAATCCCCAGCTCTGCTGTCCGCGGGGCCTGTGATGTCCAAAATCGCGTTTGGA
ATCGCCCTCCCCGTGATCTTCATTTCTGGCTCTATCAATACAACGGTCGTATGTCGGTTCATCCATACGCGGATT
TATCGCGATTCGGTGGTTCAATACGTCAACACGGTGAAGGGATGGGTCACCTGGCTGGCGCTCGTGGTTGCCGTC
ACCCTGATCGCTTGGATAGTTGCCGAAAGTATCCCCTTCTTTTCCGAGCTCATGGCTATCAGTGCGGCTCTGCTC
GTCTCCGGGATGTCTTTCTATTTCCCTCCTGTGATGTGGCTTTTACTTCTGAAAGACGGGAATTGGCATGACCGG
AAAAATGTCTGGCATGCTGTGTGCAATCTGGTCTGTTTCCTAATCGGAATCGCAGTCCTCGGAGGTGGAGTTTAT
GCAAGTATCTTCGAATTGATCAGGAAATTCCAGGATGGGAATATGGGGAAACCTTTTTCGTGCTCGATATAA
Gene >Pro_DTO377G3_2|g6280.t1
ATGGCCGACGAGAGGGGTTACGGCTCTTTCCACCCCGGCGATAACGGTCCTTCGCCCGTGATGGGCTGTGCCAGC
CCACAACCACAAGCCGATGAAAACACCAAGTTGTTATCAAATGACGGTGATGCTGGGTTCGAGGACCAAAGGGTG
ATCGAGGGACATGCTAACTTCCATCGACTCGGGTGGAAGCGTCTCACTGTGGTCAGCATCGTCGAAGCGATCGCT
CTCGGCGCACTGAGTCTCCCCCAGGCATTTGCCGTTCTAGGGATGATCCCCGGTATAGTCATATGCGTTGGCATG
GGAATTGTTGCCATTTATACCAGTTACATCATCGGAGCAGTCAAGATAAAATTCCCTTCGGTTGCCCACTATGGA
GACATTGGGCAGCTGATGATGGGGAGCTTTGGCTACTGGCTGTTCAGTGTAATATTCGTCTTTCAACTGACACTC
TCTGTTGGATCCCACTGCCTTACGGGCATGATCGCCTTTGCAAATATTACTGAGAGTACAATTTGCGCTCTAGTA
TTTGGTGGTATCTCCGCTGTCATTCTACTCTTATTGGCGATACCGCCAACATTCGCCGATGTTGCAATCCTAGGC
TATGTTGACTTCGTTTCTATCATTCTGGCAATCGGAGTCACCATGGTCGGCACTGGAATCCAACAGGCTCAGATG
CCCGGTGGATTAGCGAGTTCAGACTGGTCTTACTGGCCGGCCGAGGATGTCACGTTCCCTAAAGCAGCGGTTGCT
ATCAGCAACATCGTCTTTGCCTACGCCTTTGCTGGTGCTTTGCCGTCATTCATGAACGAAATGCATACGCCGAAA
GACTATGTCAAATCGATAACTGCACTCGGCGTCATCGAAATCTCAATCTATGTGCTCACCGGGTCTATCATCTAT
GCATTTGTCGGACAGGATGTTCAATCCCCAGCTCTGCTGTCCGCGGGGCCTGTGATGTCCAAAATCGCGTTTGGA
ATCGCCCTCCCCGTGATCTTCATTTCTGGCTCTATCAATACAACGGTCGTATGTCGGTTCATCCATACGCGGATT
TATCGCGATTCGGTGGTTCAATACGTCAACACGGTGAAGGGATGGGTCACCTGGCTGGCGCTCGTGGTTGCCGTC
ACCCTGATCGCTTGGATAGTTGCCGAAAGTATCCCCTTCTTTTCCGAGCTCATGGCTATCAGTGCGGCTCTGCTC
GTCTCCGGGATGTCTTTCTATTTCCCTCCTGTGATGTGGCTTTTACTTCTGAAAGACGGGAATTGGCATGACCGG
AAAAATGTCTGGCATGCTGTGTGCAATCTGGTCTGTTTCCTAATCGGAATCGCAGTCCTCGGAGGTGGAGTTTAT
GCAAGTATCTTCGAATTGGTGAGTTCCGTGAAATCCGTCTCCATTCCATCTTGCTAATTTAGGTAAACAGATCAG
GAAATTCCAGGATGGGAATATGGGGAAACCTTTTTCGTGCTCGATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail