Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6251.t1
Gene name
Locationscaffold_16:330682..333591
Strand+
Gene length (bp)2909
Transcript length (bp)2790
Coding sequence length (bp)2790
Protein length (aa) 930

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 1.7E-18 584 669
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 3.7E-15 728 805
PF00271 Helicase_C Helicase conserved C-terminal domain 3.4E-15 391 519
PF00270 DEAD DEAD/DEAH box helicase 2.0E-06 198 348

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004386 helicase activity Yes
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 33.03 20.05 46.01
5d_25C Five days - 25 degrees Celsius 30.26 18.32 42.20
7d_25C Seven days - 25 degrees Celsius 31.35 18.98 43.73
10d_25C Ten days - 25 degrees Celsius 34.54 21.03 48.06
7d_15C Seven days - 15 degrees Celsius 33.53 20.11 46.96
7d_30C Seven days - 30 degrees Celsius 29.50 17.79 41.20

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.767298 no
3d_25C 7d_25C 0.873025 no
3d_25C 7d_15C 0.967141 no
3d_25C 7d_30C 0.686157 no
3d_25C 10d_25C 0.892666 no
5d_25C 7d_25C 0.918559 no
5d_25C 7d_15C 0.729404 no
5d_25C 7d_30C 0.940031 no
5d_25C 10d_25C 0.636583 no
7d_25C 7d_15C 0.831130 no
7d_25C 7d_30C 0.845925 no
7d_25C 10d_25C 0.740943 no
7d_15C 7d_30C 0.641587 no
7d_15C 10d_25C 0.931534 no
7d_30C 10d_25C 0.549091 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6251.t1
MSRNEMGPPAKRHKGFGHLPAGLRDAKRKDIDNWETNRMLTSGVAQRRDHEGDFMPEDEEATRVHLLVHDLRPPF
LDGRTIFTKQLEPISAVRDPQSDMAVFSRKGSRVVNERRQQRERQKQAQEATNMAGTALGNFMGIKEDEGDSAVA
VPIEDTYKGGGNKFARHMKKDGGSSAFSNSKTMREQREYLPAFAVREDLMRVIRDNQVVVVVGETGSGKTTQLTQ
FLHEDGYSKFGMIGCTQPRRVAAMSVAKRVSEEMDVELGGLVGYAIRFEDCTSDDTLIKYMTDGVLLRESLTQKD
LDKYSCIIMDEAHERALNTDVLMGLLKKVLTRRRDLKLIVTSATMNSERFSRFFGGAAEFVIPGRTFPVDLHFSR
TPCEDYVDSAVKQVLAIHVSQGAGDILVFMTGQEDIEATCELVEERLKQLNDPPKLSVLPIYSQMPAEQQAKIFE
KAAPGVRKVIVATNIAETSLTVDGIMFVVDAGYSKLKVYNPRMGMDSLQVTPISQANANQRSGRAGRTGPGKAYR
LYTETAYKNELYIQTIPEIQRTSLANTILLLKSLGVKDLLDFDFMDPPPQETISTSLFELWSLGALDNLGDLTSL
GRRMTPFPMDPPLAKLIIMASDVYECSEEMLTIVAMLSVANVFYRPKERQEEADSAHEKFFVPESDHLTLLHVYT
QWKTNGHSDAWCIKHFLHSKTLRRAKEVRDQLHDIMIQQKMPLVSCGTDWDLIRKCICSGFFHQAAKLKGIGEFI
NLRTSVTMALHPTSALYGIGQVPEYVVYHELILTSKEYMSTVTAVDPHWLAELGGVFYSVKEKGYSQRDRRVTEI
EFNKRMEIEEQMAADRERAAAEKLREQERNDPARRRTEIEVGGKSVVRKAIIKPGRRVGGLTASSSSSSRPGANI
DGAHDGGGNRPGSSVVKRPTVPRRPGRAF*
Coding >Pro_DTO377G3_2|g6251.t1
ATGTCTCGCAACGAGATGGGCCCTCCGGCCAAAAGGCACAAGGGCTTTGGACACCTCCCTGCAGGCCTGCGCGAC
GCAAAACGGAAGGACATTGACAATTGGGAAACCAATCGAATGCTTACTTCTGGTGTAGCGCAACGACGAGACCAT
GAGGGCGACTTCATGCCCGAAGATGAAGAAGCGACTCGCGTGCATTTACTCGTCCACGATCTCAGGCCGCCTTTT
CTCGACGGTCGTACGATCTTCACGAAGCAACTGGAGCCGATCTCCGCTGTTCGAGATCCGCAAAGTGACATGGCG
GTATTCAGTCGGAAAGGAAGCAGGGTCGTTAATGAGCGCCGGCAGCAGCGAGAACGACAAAAGCAAGCACAGGAG
GCGACAAATATGGCCGGCACAGCTCTGGGGAACTTCATGGGCATCAAAGAGGACGAAGGAGACAGCGCTGTCGCT
GTGCCCATCGAGGATACCTACAAAGGAGGAGGAAACAAATTTGCCAGACATATGAAGAAAGACGGTGGCTCTAGC
GCTTTCAGCAATAGCAAGACCATGCGCGAACAGAGAGAGTATCTGCCCGCCTTTGCCGTGCGAGAGGATCTTATG
AGAGTCATTCGGGATAACCAAGTTGTGGTGGTCGTTGGAGAGACCGGATCTGGGAAAACCACCCAGCTAACTCAA
TTTCTACACGAGGATGGCTATTCTAAGTTCGGTATGATCGGATGCACGCAGCCTCGCCGTGTAGCTGCTATGAGT
GTCGCTAAGCGAGTCAGCGAGGAGATGGACGTCGAGCTCGGTGGACTCGTCGGATACGCTATCCGTTTCGAGGAT
TGTACGAGTGACGACACGTTGATCAAATACATGACGGATGGTGTATTGCTGCGAGAGTCTCTCACCCAAAAGGAT
CTCGACAAATACTCATGTATCATTATGGACGAGGCACACGAAAGAGCCTTGAACACTGACGTCTTGATGGGTCTC
CTTAAAAAAGTCCTGACCCGCCGCAGGGATCTGAAATTGATCGTGACCTCAGCAACAATGAACTCTGAACGATTT
TCGCGCTTCTTTGGCGGTGCCGCAGAATTCGTCATTCCCGGCAGAACCTTCCCTGTTGATCTTCACTTCTCGCGC
ACACCCTGTGAAGATTATGTCGATAGTGCGGTCAAGCAGGTCTTGGCCATTCATGTGTCTCAGGGCGCTGGTGAT
ATTCTTGTCTTCATGACTGGCCAAGAAGATATCGAGGCAACCTGCGAGCTGGTTGAAGAAAGGCTGAAGCAGCTG
AATGATCCGCCGAAACTCAGCGTTCTACCCATCTACAGTCAAATGCCGGCCGAGCAACAGGCAAAGATCTTTGAG
AAGGCCGCCCCGGGCGTGCGCAAAGTAATTGTGGCTACAAATATTGCTGAGACAAGTCTAACGGTCGACGGTATC
ATGTTCGTTGTGGATGCAGGTTACTCAAAGCTGAAAGTGTACAACCCGCGCATGGGTATGGACTCTCTCCAGGTC
ACCCCGATTTCCCAAGCCAATGCAAACCAGCGATCTGGACGTGCTGGGCGGACTGGACCGGGCAAGGCCTATCGT
CTATATACGGAAACAGCCTACAAGAACGAGCTTTACATTCAAACCATCCCTGAGATTCAGCGAACCAGTCTTGCC
AATACCATACTGTTACTGAAATCCCTTGGTGTGAAGGACCTTTTGGACTTCGACTTCATGGATCCTCCCCCACAA
GAGACAATCTCTACCTCTCTTTTCGAGCTCTGGTCGCTGGGTGCTCTGGACAACCTGGGTGATCTTACATCTCTA
GGACGTCGCATGACACCATTCCCCATGGATCCCCCTCTTGCCAAGCTCATAATCATGGCCTCCGATGTATACGAG
TGCAGCGAAGAAATGTTAACCATCGTCGCAATGCTTTCGGTTGCAAATGTCTTTTATCGTCCCAAAGAACGACAG
GAGGAAGCCGATTCAGCCCACGAGAAATTCTTCGTTCCAGAATCCGATCACTTGACCCTTCTCCACGTTTATACT
CAATGGAAAACCAACGGTCACTCAGATGCCTGGTGCATCAAGCACTTTTTGCACTCCAAAACGCTCCGCCGCGCC
AAGGAAGTCCGAGACCAACTTCACGACATAATGATCCAACAAAAAATGCCCCTCGTCAGCTGCGGTACAGACTGG
GACTTGATCCGCAAGTGCATCTGTTCGGGCTTCTTCCATCAAGCCGCAAAACTAAAGGGCATTGGCGAGTTCATT
AACCTCCGCACCAGCGTGACTATGGCGCTCCATCCCACCAGTGCCCTTTACGGTATCGGCCAAGTGCCCGAGTAC
GTCGTCTACCACGAGTTAATCCTGACGTCCAAGGAATACATGTCCACAGTGACAGCCGTTGACCCTCATTGGCTC
GCCGAACTCGGTGGCGTATTCTACTCCGTTAAAGAAAAAGGCTACTCGCAGCGCGACCGCCGCGTGACAGAAATC
GAGTTCAACAAGCGCATGGAAATCGAAGAGCAGATGGCAGCTGACCGTGAACGTGCTGCTGCCGAGAAATTGCGC
GAGCAGGAACGCAACGACCCAGCCCGCCGCAGAACGGAAATCGAGGTTGGCGGAAAGTCCGTCGTGCGTAAAGCT
ATCATCAAGCCAGGACGCAGGGTCGGCGGTTTGACTGCTTCATCTTCATCTTCCTCGCGACCTGGAGCCAATATC
GATGGCGCTCATGATGGAGGTGGAAATCGTCCCGGAAGCAGTGTGGTCAAGAGGCCTACGGTGCCTCGGAGACCA
GGACGTGCATTCTAG
Transcript >Pro_DTO377G3_2|g6251.t1
ATGTCTCGCAACGAGATGGGCCCTCCGGCCAAAAGGCACAAGGGCTTTGGACACCTCCCTGCAGGCCTGCGCGAC
GCAAAACGGAAGGACATTGACAATTGGGAAACCAATCGAATGCTTACTTCTGGTGTAGCGCAACGACGAGACCAT
GAGGGCGACTTCATGCCCGAAGATGAAGAAGCGACTCGCGTGCATTTACTCGTCCACGATCTCAGGCCGCCTTTT
CTCGACGGTCGTACGATCTTCACGAAGCAACTGGAGCCGATCTCCGCTGTTCGAGATCCGCAAAGTGACATGGCG
GTATTCAGTCGGAAAGGAAGCAGGGTCGTTAATGAGCGCCGGCAGCAGCGAGAACGACAAAAGCAAGCACAGGAG
GCGACAAATATGGCCGGCACAGCTCTGGGGAACTTCATGGGCATCAAAGAGGACGAAGGAGACAGCGCTGTCGCT
GTGCCCATCGAGGATACCTACAAAGGAGGAGGAAACAAATTTGCCAGACATATGAAGAAAGACGGTGGCTCTAGC
GCTTTCAGCAATAGCAAGACCATGCGCGAACAGAGAGAGTATCTGCCCGCCTTTGCCGTGCGAGAGGATCTTATG
AGAGTCATTCGGGATAACCAAGTTGTGGTGGTCGTTGGAGAGACCGGATCTGGGAAAACCACCCAGCTAACTCAA
TTTCTACACGAGGATGGCTATTCTAAGTTCGGTATGATCGGATGCACGCAGCCTCGCCGTGTAGCTGCTATGAGT
GTCGCTAAGCGAGTCAGCGAGGAGATGGACGTCGAGCTCGGTGGACTCGTCGGATACGCTATCCGTTTCGAGGAT
TGTACGAGTGACGACACGTTGATCAAATACATGACGGATGGTGTATTGCTGCGAGAGTCTCTCACCCAAAAGGAT
CTCGACAAATACTCATGTATCATTATGGACGAGGCACACGAAAGAGCCTTGAACACTGACGTCTTGATGGGTCTC
CTTAAAAAAGTCCTGACCCGCCGCAGGGATCTGAAATTGATCGTGACCTCAGCAACAATGAACTCTGAACGATTT
TCGCGCTTCTTTGGCGGTGCCGCAGAATTCGTCATTCCCGGCAGAACCTTCCCTGTTGATCTTCACTTCTCGCGC
ACACCCTGTGAAGATTATGTCGATAGTGCGGTCAAGCAGGTCTTGGCCATTCATGTGTCTCAGGGCGCTGGTGAT
ATTCTTGTCTTCATGACTGGCCAAGAAGATATCGAGGCAACCTGCGAGCTGGTTGAAGAAAGGCTGAAGCAGCTG
AATGATCCGCCGAAACTCAGCGTTCTACCCATCTACAGTCAAATGCCGGCCGAGCAACAGGCAAAGATCTTTGAG
AAGGCCGCCCCGGGCGTGCGCAAAGTAATTGTGGCTACAAATATTGCTGAGACAAGTCTAACGGTCGACGGTATC
ATGTTCGTTGTGGATGCAGGTTACTCAAAGCTGAAAGTGTACAACCCGCGCATGGGTATGGACTCTCTCCAGGTC
ACCCCGATTTCCCAAGCCAATGCAAACCAGCGATCTGGACGTGCTGGGCGGACTGGACCGGGCAAGGCCTATCGT
CTATATACGGAAACAGCCTACAAGAACGAGCTTTACATTCAAACCATCCCTGAGATTCAGCGAACCAGTCTTGCC
AATACCATACTGTTACTGAAATCCCTTGGTGTGAAGGACCTTTTGGACTTCGACTTCATGGATCCTCCCCCACAA
GAGACAATCTCTACCTCTCTTTTCGAGCTCTGGTCGCTGGGTGCTCTGGACAACCTGGGTGATCTTACATCTCTA
GGACGTCGCATGACACCATTCCCCATGGATCCCCCTCTTGCCAAGCTCATAATCATGGCCTCCGATGTATACGAG
TGCAGCGAAGAAATGTTAACCATCGTCGCAATGCTTTCGGTTGCAAATGTCTTTTATCGTCCCAAAGAACGACAG
GAGGAAGCCGATTCAGCCCACGAGAAATTCTTCGTTCCAGAATCCGATCACTTGACCCTTCTCCACGTTTATACT
CAATGGAAAACCAACGGTCACTCAGATGCCTGGTGCATCAAGCACTTTTTGCACTCCAAAACGCTCCGCCGCGCC
AAGGAAGTCCGAGACCAACTTCACGACATAATGATCCAACAAAAAATGCCCCTCGTCAGCTGCGGTACAGACTGG
GACTTGATCCGCAAGTGCATCTGTTCGGGCTTCTTCCATCAAGCCGCAAAACTAAAGGGCATTGGCGAGTTCATT
AACCTCCGCACCAGCGTGACTATGGCGCTCCATCCCACCAGTGCCCTTTACGGTATCGGCCAAGTGCCCGAGTAC
GTCGTCTACCACGAGTTAATCCTGACGTCCAAGGAATACATGTCCACAGTGACAGCCGTTGACCCTCATTGGCTC
GCCGAACTCGGTGGCGTATTCTACTCCGTTAAAGAAAAAGGCTACTCGCAGCGCGACCGCCGCGTGACAGAAATC
GAGTTCAACAAGCGCATGGAAATCGAAGAGCAGATGGCAGCTGACCGTGAACGTGCTGCTGCCGAGAAATTGCGC
GAGCAGGAACGCAACGACCCAGCCCGCCGCAGAACGGAAATCGAGGTTGGCGGAAAGTCCGTCGTGCGTAAAGCT
ATCATCAAGCCAGGACGCAGGGTCGGCGGTTTGACTGCTTCATCTTCATCTTCCTCGCGACCTGGAGCCAATATC
GATGGCGCTCATGATGGAGGTGGAAATCGTCCCGGAAGCAGTGTGGTCAAGAGGCCTACGGTGCCTCGGAGACCA
GGACGTGCATTCTAG
Gene >Pro_DTO377G3_2|g6251.t1
ATGTCTCGCAACGAGATGGGCCCTCCGGCCAAAAGGCACAAGGGCTTTGGACACCTCCCTGCAGGCCTGCGCGAC
GCAAAACGGAAGGACATTGACAATTGGGAAACCAATCGAATGCTTACTTCTGGTGTAGCGCAACGACGAGACCAT
GAGGGCGACTTCATGCCCGAAGATGAAGAAGCGACTCGCGTGCATTTACTCGTCCACGATCTCAGGCCGCCTTTT
CTCGACGGTCGTACGATCTTCACGAAGCAACTGGAGCCGATCTCCGCTGTTCGAGATCCGCAAAGTGACATGGCG
GTATTCAGTCGGAAAGGAAGCAGGGTCGTTAATGAGCGCCGGCAGCAGCGAGAACGACAAAAGCAAGCACAGGAG
GCGACAAATATGGCCGGCACAGCTCTGGGGAACTTCATGGGCATCAAAGAGGACGAAGGAGACAGCGCTGTCGCT
GTGCCCATCGAGGATACCTACAAAGGAGGAGGAAACAAATTTGCCAGACATATGAAGAAAGACGGTGGCTCTAGC
GCTTTCAGCAATAGCAAGACCATGCGCGAACAGAGAGAGTATCTGCCCGCCTTTGCCGTGCGAGAGGATCTTATG
AGAGTCATTCGGGATAACCAAGTTGTGGTGGTCGTTGGAGAGACCGGATCTGGGAAAACCACCCAGCTAACTCAA
TTTCTACACGAGGATGGCTATTCTAAGTTCGGTATGATCGGATGCACGCAGCCTCGCCGTGTAGCTGCTATGAGT
GTCGCTAAGCGAGTCAGCGAGGAGATGGACGTCGAGCTCGGTGGACTCGTCGGATACGCTATCCGTTTCGAGGAT
TGTACGAGTGACGACACGTTGATCAAATGTGAGTTTCTTCTTTCCGCTTTGGTGTGATCATATAGCTAATTTATG
TACTAGACATGACGGATGGTGTATTGCTGCGAGAGTCTCTCACCCAAAAGGATCTCGACAAATACTCATGTATCA
TTATGGACGAGGCACACGAAAGAGCCTTGAACACTGACGTCTTGATGGGTCTCCTTAAAAAAGTCCTGACCCGCC
GCAGGGATCTGAAATTGATCGTGACCTCAGCAACAATGAACTCTGAACGATTTTCGCGCTTCTTTGGCGGTGCCG
CAGAATTCGTCATTCCCGGCAGAACCTTCCCTGTTGATCTTCACTTCTCGCGCACACCCTGTGAAGATTATGTCG
ATAGTGCGGTCAAGCAGGTCTTGGCCATTCATGTGTCTCAGGGCGCTGGTGATATTCTTGTCTTCATGACTGGCC
AAGAAGATATCGAGGCAACCTGCGAGCTGGTTGAAGAAAGGCTGAAGCAGCTGAATGATCCGCCGAAACTCAGCG
TTCTACCCATCTACAGTCAAATGCCGGCCGAGCAACAGGCAAAGATCTTTGAGAAGGCCGCCCCGGGCGTGCGCA
AAGTAATTGTGGCTACAAATATTGCTGAGACAAGTCTAACGGTCGACGGTATCATGTTCGTTGTGGATGCAGGTT
ACTCAAAGCTGAAAGTGTACAACCCGCGCATGGGTATGGACTCTCTCCAGGTCACCCCGATTTCCCAAGCCAATG
CAAACCAGCGATCTGGACGTGCTGGGCGGACTGGACCGGGCAAGGCCTATCGTCTATATACGGAAACAGCCTACA
AGAACGAGCTTTACATTCAAACCATCCCTGAGATTCAGCGAACCAGTCTTGCCAATACCATACTGTTACTGAAAT
CCCTTGGTGTGAAGGACCTTTTGGACTTCGACTTCATGGATCCTCCCCCACAAGAGACAATCTCTACCTCTCTTT
TCGAGCTCTGGTCGCTGGGTGCTCTGGACAACCTGGGTGATCTTACATCTCTAGGACGTCGCATGACACCATTCC
CCATGGATCCCCCTCTTGCCAAGCTCATAATCATGGCCTCCGATGTATACGAGTGCAGCGAAGAAATGTTAACCA
TCGTCGCAATGCTTTCGGTTGCAAATGTCTTTTATCGTCCCAAAGAACGACAGGAGGAAGCCGATTCAGCCCACG
AGAAATTCTTCGTTCCAGAATCCGATCACTTGACCCTTCTCCACGTTTATACTCAATGGAAAACCAACGGTCACT
CAGATGCCTGGTGCATCAAGCACTTTTTGCACTCCAAAACGCTCCGCCGCGCCAAGGAAGTCCGAGACCAACTTC
ACGACATAATGATCCAACAAAAAATGCCCCTCGTCAGCTGCGGTACAGACTGGGACTTGATCCGCAAGTGCATCT
GTTCGGGCTTCTTCCATCAAGCCGCAAAACTAAAGGGCATTGGCGAGTTCATTAACCTCCGCACCAGCGTGACTA
TGGCGCTCCATCCCACCAGTGCCCTTTACGGTATCGGCCAAGTGCCCGAGTACGTCGTCTACCACGAGTTAATCC
TGACGTCCAAGGAATACATGTCCACAGTGACAGCCGTTGACCCTCATGTAAGTTACCACTCCCCCATTCATGCCT
GTTTGTCATCTAGTACTCAACTAACTCGTTTCTCTCAGTGGCTCGCCGAACTCGGTGGCGTATTCTACTCCGTTA
AAGAAAAAGGCTACTCGCAGCGCGACCGCCGCGTGACAGAAATCGAGTTCAACAAGCGCATGGAAATCGAAGAGC
AGATGGCAGCTGACCGTGAACGTGCTGCTGCCGAGAAATTGCGCGAGCAGGAACGCAACGACCCAGCCCGCCGCA
GAACGGAAATCGAGGTTGGCGGAAAGTCCGTCGTGCGTAAAGCTATCATCAAGCCAGGACGCAGGGTCGGCGGTT
TGACTGCTTCATCTTCATCTTCCTCGCGACCTGGAGCCAATATCGATGGCGCTCATGATGGAGGTGGAAATCGTC
CCGGAAGCAGTGTGGTCAAGAGGCCTACGGTGCCTCGGAGACCAGGACGTGCATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail