Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6205.t1
Gene name
Locationscaffold_16:224001..225301
Strand-
Gene length (bp)1300
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 4.9E-12 72 173
PF08613 Cyclin Cyclin 1.2E-06 86 172

GO

GO Term Description Terminal node
GO:0019901 protein kinase binding Yes
GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Yes
GO:0071900 regulation of protein serine/threonine kinase activity No
GO:0050794 regulation of cellular process No
GO:0051338 regulation of transferase activity No
GO:0031323 regulation of cellular metabolic process No
GO:0051726 regulation of cell cycle No
GO:0051174 regulation of phosphorus metabolic process No
GO:0050790 regulation of catalytic activity No
GO:0008150 biological_process No
GO:0019899 enzyme binding No
GO:0001932 regulation of protein phosphorylation No
GO:0043549 regulation of kinase activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019220 regulation of phosphate metabolic process No
GO:0042325 regulation of phosphorylation No
GO:0050789 regulation of biological process No
GO:0005488 binding No
GO:0031399 regulation of protein modification process No
GO:0005515 protein binding No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0065009 regulation of molecular function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0051246 regulation of protein metabolic process No
GO:0019222 regulation of metabolic process No
GO:0019900 kinase binding No
GO:0080090 regulation of primary metabolic process No
GO:0045859 regulation of protein kinase activity No
GO:1904029 regulation of cyclin-dependent protein kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6205.t1
MDSASLNRAALNEFVTVRVTREMITHLAQQAAQVIRCEAHVTNTVNQNGQPTPPSTPPMDPSDLPALPPIETFIA
SLVARSQVQVPTLMSCLVYLGRLRSRLPPVAKGMRCTVHRIFLASLILAAKNLNDSSPKNKHWARYTAVKGFEGF
GFSLPEVNLMERQLLFLLDWDLRITEQDLFTYFEPFLAPHRQRLIAQEQERIADEEYLHKQEQHREWRRLHSSAD
LLASRLRRQKLEARSETRRGNDNSLRRLPSHVSCPSMHNTHYAAQNIAEHDRYNPYQRQRASPSRTTRSVSPPSV
GDVPALSHAETFNSLCSRSSSIAPSSRGTPASISTVSSNGADDLMLADPNRSPSSLSLNHSYVDVAHIESTKSSE
PIRQPSKKLKTSNHAHSGGFVARFLASATGSYMGGRRSH*
Coding >Pro_DTO377G3_2|g6205.t1
ATGGACTCAGCATCACTCAACCGAGCTGCTCTCAATGAGTTTGTCACTGTCCGAGTGACTCGCGAAATGATCACA
CACCTGGCTCAACAGGCAGCCCAGGTCATCCGCTGTGAGGCGCATGTGACCAACACGGTCAACCAGAATGGCCAA
CCTACACCACCATCCACCCCTCCAATGGACCCCTCTGACCTGCCTGCTCTTCCCCCGATCGAGACCTTTATCGCG
TCACTTGTTGCTCGGTCGCAGGTGCAGGTGCCCACTCTCATGAGCTGTCTCGTCTACCTCGGTCGTCTTCGATCA
CGTCTGCCACCAGTCGCAAAGGGCATGCGCTGCACTGTCCATCGCATCTTCCTCGCCTCGCTCATCCTGGCCGCC
AAAAATCTGAACGACTCCAGTCCCAAGAACAAGCATTGGGCCCGTTACACTGCAGTGAAGGGATTCGAAGGTTTC
GGCTTCTCTCTCCCTGAGGTCAACCTCATGGAACGCCAGCTCCTCTTCCTTCTGGACTGGGACCTGCGCATCACC
GAGCAGGATCTCTTCACTTATTTCGAGCCTTTTCTCGCCCCCCACCGCCAGCGCTTGATAGCCCAAGAGCAAGAA
CGTATCGCCGATGAGGAATATCTCCACAAACAAGAGCAACACCGCGAGTGGCGCCGTCTTCACTCATCAGCAGAC
CTACTGGCCAGCCGACTCCGCCGTCAAAAGCTCGAGGCCCGGAGCGAGACGCGTCGCGGAAACGACAACTCTCTC
CGCCGTCTCCCTAGCCACGTCTCCTGCCCAAGCATGCACAACACCCACTACGCCGCACAGAATATCGCCGAGCAC
GATCGCTACAACCCCTACCAACGCCAGCGTGCATCCCCCAGCCGAACCACCCGCTCTGTCTCCCCACCATCCGTC
GGCGACGTGCCAGCCCTCTCCCACGCCGAGACCTTCAACTCTCTCTGCTCGCGCTCGTCCAGCATCGCCCCAAGC
TCAAGAGGCACACCAGCTTCCATCAGTACGGTTTCCTCGAACGGTGCCGACGACCTCATGCTCGCGGACCCCAAC
CGCAGCCCGTCATCCCTCTCACTGAACCACAGCTACGTGGACGTCGCCCACATCGAATCCACCAAGTCCTCGGAG
CCTATCCGCCAGCCATCCAAGAAGCTGAAGACCAGCAACCACGCGCACAGCGGCGGCTTCGTGGCTCGCTTCCTT
GCCTCCGCGACCGGCTCTTACATGGGCGGTCGTCGGTCTCACTAA
Transcript >Pro_DTO377G3_2|g6205.t1
ATGGACTCAGCATCACTCAACCGAGCTGCTCTCAATGAGTTTGTCACTGTCCGAGTGACTCGCGAAATGATCACA
CACCTGGCTCAACAGGCAGCCCAGGTCATCCGCTGTGAGGCGCATGTGACCAACACGGTCAACCAGAATGGCCAA
CCTACACCACCATCCACCCCTCCAATGGACCCCTCTGACCTGCCTGCTCTTCCCCCGATCGAGACCTTTATCGCG
TCACTTGTTGCTCGGTCGCAGGTGCAGGTGCCCACTCTCATGAGCTGTCTCGTCTACCTCGGTCGTCTTCGATCA
CGTCTGCCACCAGTCGCAAAGGGCATGCGCTGCACTGTCCATCGCATCTTCCTCGCCTCGCTCATCCTGGCCGCC
AAAAATCTGAACGACTCCAGTCCCAAGAACAAGCATTGGGCCCGTTACACTGCAGTGAAGGGATTCGAAGGTTTC
GGCTTCTCTCTCCCTGAGGTCAACCTCATGGAACGCCAGCTCCTCTTCCTTCTGGACTGGGACCTGCGCATCACC
GAGCAGGATCTCTTCACTTATTTCGAGCCTTTTCTCGCCCCCCACCGCCAGCGCTTGATAGCCCAAGAGCAAGAA
CGTATCGCCGATGAGGAATATCTCCACAAACAAGAGCAACACCGCGAGTGGCGCCGTCTTCACTCATCAGCAGAC
CTACTGGCCAGCCGACTCCGCCGTCAAAAGCTCGAGGCCCGGAGCGAGACGCGTCGCGGAAACGACAACTCTCTC
CGCCGTCTCCCTAGCCACGTCTCCTGCCCAAGCATGCACAACACCCACTACGCCGCACAGAATATCGCCGAGCAC
GATCGCTACAACCCCTACCAACGCCAGCGTGCATCCCCCAGCCGAACCACCCGCTCTGTCTCCCCACCATCCGTC
GGCGACGTGCCAGCCCTCTCCCACGCCGAGACCTTCAACTCTCTCTGCTCGCGCTCGTCCAGCATCGCCCCAAGC
TCAAGAGGCACACCAGCTTCCATCAGTACGGTTTCCTCGAACGGTGCCGACGACCTCATGCTCGCGGACCCCAAC
CGCAGCCCGTCATCCCTCTCACTGAACCACAGCTACGTGGACGTCGCCCACATCGAATCCACCAAGTCCTCGGAG
CCTATCCGCCAGCCATCCAAGAAGCTGAAGACCAGCAACCACGCGCACAGCGGCGGCTTCGTGGCTCGCTTCCTT
GCCTCCGCGACCGGCTCTTACATGGGCGGTCGTCGGTCTCACTAA
Gene >Pro_DTO377G3_2|g6205.t1
ATGGACTCAGCATCACTCAACCGAGCTGCTCTCAATGAGTTTGTCACTGTCCGAGTGACTCGCGAAATGATCACA
CACCTGGCTCAACAGGCAGCCCAGGTCATCCGCTGTGAGGCGCATGTGACCAACACGGTCAACCAGAATGGCCAA
CCTACACCACCATCCACCCCTCCAATGGACCCCTCTGACCTGCCTGCTCTTCCCCCGATCGAGACCTTTATCGCG
TCACTTGTTGCTCGGTCGCAGGTGCAGGTGCCCACTCTCATGAGCTGTCTCGTCTACCTCGGTCGTCTTCGATCA
CGTCTGCCACCAGTCGCAAAGGGCATGCGCTGCACTGTCCATCGCATCTTCCTCGCCTCGCTCATCCTGGCCGCC
AAAAATCTGAACGACTCCAGTCCCAAGAACAAGCATTGGGCCCGTTACACTGCAGTGAAGGGATTCGAAGGTTTC
GGCTTCTCTCTCCCTGAGGTCAACCTCATGGAACGCCAGCTCCTCTTCCTTCTGGACTGGGACCTGCGCATCACC
GAGCAGGATCTCTTCACTTATTTCGAGCCTTTTCTCGCCCCCCACCGCCAGCGCTTGATAGCCCAAGAGCAAGAA
CGTATCGCCGATGAGGAATATCTCCACAAACAAGAGCAACACCGCGAGTGGTACAGCATCCCATTTTACAACCTG
TTATCATAACAAATACTAACCCACCCCTAGGCGCCGTCTTCACTCATCAGCAGACCTACTGGCCAGCCGACTCCG
CCGTCAAAAGCTCGAGGCCCGGAGCGAGACGCGTCGCGGAAACGACAACTCTCTCCGCCGTCTCCCTAGCCACGT
CTCCTGCCCAAGCATGCACAACACCCACTACGCCGCACAGAATATCGCCGAGCACGATCGCTACAACCCCTACCA
ACGCCAGCGTGCATCCCCCAGCCGAACCACCCGCTCTGTCTCCCCACCATCCGTCGGCGACGTGCCAGCCCTCTC
CCACGCCGAGACCTTCAACTCTCTCTGCTCGCGCTCGTCCAGCATCGCCCCAAGCTCAAGAGGCACACCAGCTTC
CATCAGTACGGTTTCCTCGAACGGTGCCGACGACCTCATGCTCGCGGACCCCAACCGCAGCCCGTCATCCCTCTC
ACTGAACCACAGCTACGTGGACGTCGCCCACATCGAATCCACCAAGTCCTCGGAGCCTATCCGCCAGCCATCCAA
GAAGCTGAAGACCAGCAACCACGCGCACAGCGGCGGCTTCGTGGCTCGCTTCCTTGCCTCCGCGACCGGCTCTTA
CATGGGCGGTCGTCGGTCTCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail