Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g620.t1
Gene name
Locationscaffold_01:1601658..1602111
Strand+
Gene length (bp)453
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00137 ATP-synt_C ATP synthase subunit C 1.3E-08 85 146

GO

GO Term Description Terminal node
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain Yes
GO:0015991 ATP hydrolysis coupled proton transport Yes
GO:0015078 proton transmembrane transporter activity Yes
GO:0099131 ATP hydrolysis coupled ion transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0015075 ion transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0055085 transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0099132 ATP hydrolysis coupled cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0098796 membrane protein complex No
GO:1902600 proton transmembrane transport No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0006812 cation transport No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0098660 inorganic ion transmembrane transport No
GO:0006810 transport No
GO:0032991 protein-containing complex No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006811 ion transport No
GO:0015672 monovalent inorganic cation transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015988 energy coupled proton transmembrane transport, against electrochemical gradient No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0044425 membrane part No
GO:0090662 ATP hydrolysis coupled transmembrane transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 122 144 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g620.t1
MATSRVFASRMASVMAQTSKVARPAARFQLNAATKRTFTQKAPAFGAPKRIQSPTLLQAKAFQTAARRQYSSEVA
SAMVEVSKNIGMGSAAIGLGGAGIGIGLVFAALLMSVSRNPALRGQLFSYAILGFAFVEAMGLFDLMVAMMCKYV
*
Coding >Pro_DTO377G3_2|g620.t1
ATGGCCACCTCTCGTGTCTTCGCCTCCCGCATGGCCTCGGTCATGGCCCAGACCTCCAAGGTCGCCCGCCCTGCT
GCCCGCTTCCAGCTCAACGCTGCCACCAAGCGCACCTTCACCCAGAAGGCCCCCGCCTTCGGTGCCCCCAAGCGC
ATCCAGTCGCCCACTCTCCTCCAGGCCAAGGCTTTCCAGACTGCCGCCCGCCGCCAGTACTCCTCCGAGGTCGCC
TCCGCCATGGTTGAGGTCTCCAAGAACATCGGTATGGGTTCCGCCGCCATCGGTCTCGGTGGTGCCGGTATCGGT
ATCGGTCTCGTCTTCGCCGCTCTCCTCATGAGTGTCTCCCGCAACCCTGCCCTCCGTGGCCAGCTCTTCTCCTAC
GCCATTCTCGGCTTTGCCTTCGTCGAGGCCATGGGTCTCTTCGATCTCATGGTTGCCATGATGTGCAAGTACGTC
TAA
Transcript >Pro_DTO377G3_2|g620.t1
ATGGCCACCTCTCGTGTCTTCGCCTCCCGCATGGCCTCGGTCATGGCCCAGACCTCCAAGGTCGCCCGCCCTGCT
GCCCGCTTCCAGCTCAACGCTGCCACCAAGCGCACCTTCACCCAGAAGGCCCCCGCCTTCGGTGCCCCCAAGCGC
ATCCAGTCGCCCACTCTCCTCCAGGCCAAGGCTTTCCAGACTGCCGCCCGCCGCCAGTACTCCTCCGAGGTCGCC
TCCGCCATGGTTGAGGTCTCCAAGAACATCGGTATGGGTTCCGCCGCCATCGGTCTCGGTGGTGCCGGTATCGGT
ATCGGTCTCGTCTTCGCCGCTCTCCTCATGAGTGTCTCCCGCAACCCTGCCCTCCGTGGCCAGCTCTTCTCCTAC
GCCATTCTCGGCTTTGCCTTCGTCGAGGCCATGGGTCTCTTCGATCTCATGGTTGCCATGATGTGCAAGTACGTC
TAA
Gene >Pro_DTO377G3_2|g620.t1
ATGGCCACCTCTCGTGTCTTCGCCTCCCGCATGGCCTCGGTCATGGCCCAGACCTCCAAGGTCGCCCGCCCTGCT
GCCCGCTTCCAGCTCAACGCTGCCACCAAGCGCACCTTCACCCAGAAGGCCCCCGCCTTCGGTGCCCCCAAGCGC
ATCCAGTCGCCCACTCTCCTCCAGGCCAAGGCTTTCCAGACTGCCGCCCGCCGCCAGTACTCCTCCGAGGTCGCC
TCCGCCATGGTTGAGGTCTCCAAGAACATCGGTATGGGTTCCGCCGCCATCGGTCTCGGTGGTGCCGGTATCGGT
ATCGGTCTCGTCTTCGCCGCTCTCCTCATGAGTGTCTCCCGCAACCCTGCCCTCCGTGGCCAGCTCTTCTCCTAC
GCCATTCTCGGCTTTGCCTTCGTCGAGGCCATGGGTCTCTTCGATCTCATGGTTGCCATGATGTGCAAGTACGTC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail