Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6192.t1
Gene name
Locationscaffold_16:189219..195603
Strand-
Gene length (bp)6384
Transcript length (bp)6384
Coding sequence length (bp)6384
Protein length (aa) 2128

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16172 DOCK_N DOCK N-terminus 5.5E-114 193 617
PF14429 DOCK-C2 C2 domain in Dock180 and Zizimin proteins 2.5E-38 620 813
PF06920 DHR-2 Dock homology region 2 7.4E-37 1357 1851
PF00018 SH3_1 SH3 domain 4.4E-05 13 49

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6192.t1
MPWRPLPRIAFAVAIYPFNPSSPADLPLELGDELYIIEQGGTDGEWCRGYLVAPPSLLAGLTSIKGQTLEARVFS
GIFPRNCVEIREVLGDGDGYKALLNADRKSIDRLTLSGWDGEFLSRNSLAYSVSDFQAVAEVSDVVLAKKGKPSQ
IIIHKTDGSDQASPRWRTGSIPHTPVSFAPRDPDAPKPPAPVPMLKIGDETPTSLTEPLVDEIASCLREWHSTNL
HELLLARRYDVLEEMSTVVQELDFARRQLLHNVLTGKEKEALRNDTVWKLVKANKMLSGDVIVRDPEQRGRLLTG
DDSAIQLAKLQSEMSMLESSPTQTSDATALHHLLLEINAVSGNAPGQVTIGIQLFSRSDAGSLSPLSETYSLDIP
SPDKFVNMSQSSRLKTLFTELAATDIGDGSPNGRQLYLVAWVRAPETRSTADTTPVSRPSISRDTPTPTKATTNG
SVQPSAKGSLKTRRSMMWTPKQRGPSLDQPPRPITQGIPRTSSSASSVKDTTTPQPAPTKEVSAIRTVGVGILEI
SPILRQDKDTEQVINIWSPRRDGEDGEGLTDGFDKLIRALLPSPTGRYVRADPAARLHLHLRPFASCDAEFLIRQ
NPTILHDVIQTQRIGFSKAPTKPRSDIYVTLCQAVFPTDALLSHPQAGQIPLQAASGLHNLQLTLEVRDSKGARI
DKCVFPSSSKTSNTAWRTTIAQRGTPWNQTIRLKIPTEQIPGSHIVMSVADAPEFPFALAWMPLWDQQAFIRDGH
HSLLLHAYDKQTSSIENGKGAYLNLPWSALGKNESAKDEAVTGPLATLHLETHLCSTEYSQDQVILSLLNWRERP
VDEVLDTLKRLLFVPEIEIVKQLSGVFDALFGILVENAGNEEYENLIFNNLVTVLGIVHDRRYNLGPLVDRYADE
QFNFPFVTPCLIRSYLRLLNAGTDGTQSRNLRAAFKVGRHLLKFIIKAREQQKAKEEGIGITTVQSTFNRDMRTI
FKAMETLMRNSSPALVGSKTLVVQHFHTWLPELSNVLSKDEIIMIALSFMDSCKDVTGMLILYKLVLIQNYTLFD
VFASGDERRTLISSCIGWLTPYWGSTSGVSDLYRDQVRLSNSIVAQLLSQPDPLLYGFMPAIVASYCAISTEGVE
ESEYLSLLFSKAFPFQMKTAKTPQSFDESLVELSALMAAIAKIASPKLPNLKELELALFVAQTLEAHNSILDCEA
YPETWFSIHVYNHRATIKSLEHIAVLLIDKLLPAPDDADTFDTKLWESFFTTLLKVISSDVLALETFPEQKRRAV
WKIAGDVREQGADLLQSTWEAIGWETTDDERERFNLKRLGGYQVQYVPGLVPPIIGLCLSVHEGLRHVAVQILQT
MILSEWDLNQDISIIETEIISSLDTLFKSKQMNESVSQKVFIGELLDLFERETISDDLLSNAVKSLVGTVDELLD
LLVASQSGASTQSLHALKLMEYMKDMGREDIFIRYVHELADAQAAAGNFTEAGLALQFHADLYEWDPIKPMPELL
RPAFPAQNAFERREALYFSIIQNFENAMAWGPALACYKELAVHYEHTTMDFAKLSRAQSSMARIYDYIAKGNKQF
PRYFRVVYKGLGFPPGLRDKEFIFEACPTERMASFVDRMQREHPTAQVMSTGEIPDYEGQFLQISAVSAYRDVSH
PVYQRPKVPSSVREHLLISDPSRFSSTSRRHTTSSDVREHFVQKLVFTVSEAFPNILRRSEVISAEEVTLSPLQT
AIERTWRKTQELQLIGRRAASGEDSGLSNLTDALESLLDHSSSTSNCVASYRVFLSDAEMARNKLLEELDEDGEI
VQATQQPVDPMETALFVALVDHALAIKQALALYQRPAQQATQAELLRRFEDVFEPELGSLVPAPQEYSSPTPTQT
ARQSPSSSDNRRMPPIQRVGSSEQDLNRAARNNAHTRKRSDRQSVSQRISIINPFKRSHGATNSIFTIQQSDSKG
QIVGEEDENLDDDTATINSRTTSHSRGGRSERRRSFFGDKTYKHGSSPSVAHESQTSLNTHNVPHDTAARSHDGR
SRADSQQRGPVATGAATDRIAPASSGGWSTLPSTRDYSRPATRDSNVMTLTTTNGTAPLSPVLNNSNSGMRDSVF
RRFSMLKGVGRKSSRMDFKANGVLPEE*
Coding >Pro_DTO377G3_2|g6192.t1
ATGCCCTGGCGGCCGCTGCCTCGCATCGCATTTGCCGTTGCCATATACCCTTTCAACCCGTCCTCCCCCGCAGAT
CTACCATTGGAGCTTGGCGATGAGCTTTACATAATTGAGCAAGGAGGGACGGACGGCGAATGGTGTCGAGGCTAT
CTAGTCGCGCCGCCGTCGTTACTGGCCGGCTTGACAAGCATCAAAGGCCAAACTCTCGAAGCTCGTGTATTCTCG
GGTATCTTCCCGCGGAACTGCGTTGAGATTAGAGAGGTGCTAGGCGACGGCGATGGATATAAAGCACTACTAAAT
GCTGACCGGAAAAGCATTGATCGACTGACCTTGTCCGGCTGGGATGGAGAATTCCTGTCCCGAAATAGTCTGGCT
TATTCCGTCAGTGACTTTCAGGCTGTTGCCGAGGTGTCGGACGTCGTCCTTGCGAAAAAGGGGAAGCCTTCCCAG
ATTATCATTCACAAGACCGATGGGTCAGACCAGGCAAGTCCGCGATGGCGAACAGGCTCGATCCCGCATACGCCT
GTCTCATTTGCTCCTCGCGACCCTGATGCGCCGAAGCCGCCTGCCCCCGTCCCGATGCTTAAGATCGGCGATGAA
ACTCCGACCTCTCTCACAGAGCCCCTAGTGGATGAAATCGCATCGTGTCTGCGCGAATGGCATTCGACTAATTTG
CATGAATTACTTTTGGCACGCCGGTATGATGTATTGGAGGAAATGTCAACCGTGGTACAAGAGCTGGACTTTGCG
AGACGACAATTACTACACAATGTTCTGACTGGAAAGGAGAAGGAAGCATTGCGGAACGACACAGTCTGGAAACTT
GTCAAGGCAAACAAAATGCTTAGCGGGGACGTGATTGTTCGCGATCCGGAGCAGAGAGGCCGTTTGCTAACGGGT
GATGACTCTGCTATCCAATTGGCGAAGCTGCAGTCCGAGATGAGTATGCTCGAATCCAGTCCCACCCAGACATCC
GATGCTACTGCACTCCATCATTTGCTGCTGGAGATCAACGCGGTATCAGGGAATGCACCGGGGCAAGTGACTATC
GGAATACAGCTGTTCTCCCGGTCAGACGCTGGTTCACTCAGTCCATTATCTGAGACCTATAGCTTAGATATTCCG
TCTCCTGATAAATTCGTCAACATGAGCCAAAGCAGTAGACTGAAGACACTGTTCACCGAATTGGCCGCAACAGAC
ATCGGAGATGGATCTCCGAATGGGCGGCAGCTTTATCTAGTTGCTTGGGTTCGTGCCCCAGAGACCCGGTCCACA
GCTGATACCACTCCTGTGTCGAGGCCATCAATCTCGCGAGACACCCCAACCCCAACCAAGGCCACGACAAATGGT
AGTGTTCAACCTTCGGCCAAGGGTAGTTTGAAAACGCGACGCAGCATGATGTGGACACCCAAGCAACGCGGACCG
AGCTTGGATCAGCCACCTAGGCCCATTACTCAAGGAATTCCACGAACATCGAGCAGTGCGTCCAGCGTCAAAGAC
ACAACCACCCCTCAACCCGCACCAACAAAGGAGGTCTCGGCGATCCGTACTGTTGGCGTTGGGATCTTGGAGATA
TCGCCGATTCTTCGACAGGATAAGGACACTGAACAAGTGATCAACATTTGGTCGCCCCGTCGAGACGGCGAAGAC
GGCGAGGGGCTGACGGATGGCTTTGACAAGTTGATCCGCGCCTTGCTTCCTAGTCCCACCGGCCGGTATGTACGT
GCCGACCCCGCAGCACGTTTACACCTCCATCTGCGCCCCTTTGCCAGTTGCGATGCGGAATTCCTGATTCGTCAG
AATCCTACTATATTGCACGATGTCATACAGACACAGCGCATTGGATTCTCCAAGGCTCCTACGAAGCCAAGATCC
GATATCTACGTTACACTCTGTCAGGCGGTATTCCCCACAGATGCTCTCCTGTCTCACCCGCAAGCAGGTCAAATT
CCTCTGCAGGCGGCCAGCGGACTTCACAATCTTCAACTCACTCTTGAAGTACGTGATTCTAAAGGAGCTCGGATA
GACAAATGTGTCTTCCCTTCGTCATCCAAAACTTCAAACACGGCATGGCGCACTACCATCGCCCAGCGCGGCACA
CCTTGGAACCAGACCATCCGCCTCAAGATCCCCACAGAACAAATCCCTGGCTCGCACATAGTGATGAGTGTTGCA
GATGCGCCAGAATTTCCCTTTGCTCTTGCCTGGATGCCCCTTTGGGATCAGCAAGCTTTCATTAGAGATGGGCAT
CATTCTCTGCTGTTGCATGCTTATGACAAGCAGACATCCAGCATTGAGAATGGAAAGGGTGCTTATCTGAACCTC
CCATGGAGCGCGCTCGGCAAGAATGAATCCGCCAAAGATGAAGCTGTGACGGGTCCATTGGCCACTTTGCACCTT
GAAACCCATCTTTGCAGCACAGAGTACTCCCAGGATCAAGTCATTCTGAGTCTTCTCAACTGGCGAGAGCGGCCC
GTGGACGAGGTCTTGGATACCCTGAAACGTTTACTTTTTGTTCCCGAAATCGAGATTGTGAAACAACTAAGTGGT
GTCTTCGACGCGCTGTTCGGAATCCTGGTGGAGAATGCTGGTAATGAAGAATACGAGAACTTGATCTTCAACAAC
CTGGTCACTGTTCTGGGAATTGTCCATGATCGACGATACAACCTAGGCCCGCTGGTCGACCGGTACGCCGATGAG
CAGTTCAACTTCCCATTCGTCACCCCGTGCCTTATTCGAAGCTACTTGCGCCTCTTAAACGCAGGGACCGACGGT
ACGCAATCTCGCAATCTCCGTGCCGCCTTCAAGGTGGGACGCCATCTGTTAAAATTCATCATCAAGGCTCGCGAG
CAGCAAAAGGCCAAGGAGGAAGGTATTGGCATCACCACGGTGCAATCCACCTTCAACAGAGACATGCGTACCATT
TTCAAGGCTATGGAGACTTTGATGAGAAACTCGTCGCCGGCTTTGGTGGGCAGCAAAACACTGGTAGTTCAACAT
TTCCATACGTGGCTACCTGAGCTCTCCAACGTCCTGAGCAAGGATGAAATAATTATGATCGCTCTGAGTTTCATG
GATTCATGCAAGGATGTCACCGGCATGTTGATACTCTATAAGCTAGTTCTCATTCAGAATTATACTCTGTTTGAT
GTTTTCGCCTCCGGCGACGAGAGACGAACATTGATCTCCAGCTGTATTGGCTGGTTGACTCCATACTGGGGTTCC
ACCTCAGGCGTCTCGGATTTGTATCGAGATCAGGTGCGACTGAGCAACTCAATCGTGGCTCAATTGCTCAGTCAG
CCTGATCCTCTGCTTTATGGATTCATGCCAGCTATCGTCGCCTCTTACTGTGCTATCTCCACTGAGGGAGTAGAG
GAGTCGGAGTATCTTTCTTTGCTTTTCAGCAAGGCGTTCCCCTTCCAGATGAAGACTGCCAAGACCCCTCAAAGC
TTCGATGAGTCTTTGGTGGAACTGTCTGCGCTCATGGCTGCCATTGCCAAGATCGCGTCTCCCAAGCTACCCAAC
TTGAAAGAATTGGAGCTTGCACTATTTGTTGCTCAGACCCTTGAGGCTCACAACTCCATCCTCGACTGCGAGGCT
TATCCCGAGACCTGGTTCAGTATTCATGTGTACAACCATCGCGCGACTATCAAGAGTCTTGAACATATTGCAGTG
TTGCTAATTGATAAACTCCTTCCGGCACCGGATGATGCCGACACATTCGATACCAAGCTGTGGGAGTCGTTTTTC
ACGACTCTGTTAAAGGTGATCTCTAGTGATGTCCTTGCGCTCGAAACTTTCCCCGAGCAGAAGCGCCGCGCTGTC
TGGAAGATCGCCGGCGATGTGCGCGAGCAAGGTGCGGACTTATTGCAATCTACCTGGGAAGCCATTGGTTGGGAG
ACTACGGACGACGAGAGGGAGCGATTCAATCTGAAAAGGCTGGGCGGTTATCAGGTCCAGTATGTTCCCGGCCTG
GTGCCTCCCATCATTGGTCTGTGTCTCAGTGTCCACGAGGGGCTGCGACATGTTGCTGTTCAAATACTGCAGACG
ATGATTCTGAGTGAATGGGATCTGAACCAAGATATCTCCATTATTGAAACGGAGATCATCTCTAGCCTGGATACG
CTCTTCAAGTCCAAGCAGATGAACGAGAGCGTCAGCCAGAAGGTTTTCATCGGCGAGCTGTTGGATCTGTTCGAG
AGGGAAACTATATCCGATGATCTGTTGTCGAATGCTGTCAAGAGTCTGGTCGGGACAGTCGATGAGCTCTTGGAT
CTTTTGGTGGCTTCTCAGAGCGGTGCCTCAACCCAAAGTTTGCACGCTCTGAAATTAATGGAATATATGAAGGAC
ATGGGTCGCGAGGACATCTTTATTCGTTACGTTCATGAACTTGCGGATGCTCAGGCTGCGGCAGGTAACTTCACT
GAAGCAGGTCTTGCCCTTCAGTTCCATGCCGATCTCTACGAATGGGATCCCATCAAGCCTATGCCGGAGCTACTC
AGGCCCGCATTCCCAGCCCAGAATGCATTCGAACGGAGAGAGGCTTTATACTTCTCCATTATCCAGAACTTCGAA
AATGCCATGGCCTGGGGCCCCGCGTTAGCTTGCTATAAGGAGCTCGCGGTGCACTATGAGCACACGACAATGGAC
TTCGCCAAGCTCTCCCGAGCCCAAAGCTCCATGGCTCGAATTTATGACTACATCGCCAAGGGCAACAAACAATTC
CCGCGTTACTTCCGTGTGGTCTACAAGGGTCTTGGGTTTCCTCCCGGCCTACGCGATAAGGAGTTCATATTCGAA
GCGTGTCCGACTGAACGCATGGCCTCTTTTGTGGATCGTATGCAGCGGGAACACCCTACTGCGCAGGTCATGTCT
ACTGGCGAGATACCTGACTATGAGGGCCAGTTCCTTCAGATCAGCGCCGTTAGCGCATACCGCGATGTGTCTCAT
CCTGTCTACCAGCGCCCCAAGGTTCCGTCTTCTGTCCGCGAGCACCTGTTGATCTCGGATCCATCTCGCTTCTCT
TCCACTTCGCGACGACACACGACCAGCTCGGATGTCCGGGAGCACTTCGTTCAAAAGCTCGTCTTCACTGTCTCG
GAAGCATTTCCGAATATCCTCCGTCGTAGTGAGGTCATTTCTGCCGAAGAGGTTACGCTCTCGCCTCTGCAGACT
GCTATTGAGCGCACGTGGCGCAAAACACAGGAGCTTCAGCTTATTGGACGCCGTGCTGCGTCGGGTGAGGATTCT
GGTCTATCTAATCTGACCGATGCCCTAGAATCACTGCTTGACCACAGCTCGTCAACCTCTAACTGTGTGGCATCG
TATCGGGTATTCCTATCCGATGCGGAGATGGCAAGGAACAAGCTGCTTGAGGAACTTGATGAAGACGGTGAAATA
GTACAAGCAACACAGCAGCCGGTGGACCCAATGGAGACGGCGCTCTTCGTTGCACTCGTCGACCACGCCTTGGCT
ATCAAACAAGCATTGGCTCTTTACCAGCGCCCCGCTCAGCAAGCTACCCAAGCCGAACTACTCCGACGCTTTGAA
GATGTCTTCGAGCCCGAGTTAGGTTCTCTCGTCCCTGCTCCGCAGGAGTATTCATCACCTACGCCTACACAAACA
GCTCGCCAGTCCCCCTCCTCGAGCGACAATCGTCGAATGCCACCTATCCAGCGAGTCGGCAGTTCAGAACAAGAC
CTCAACCGCGCAGCCCGAAACAATGCCCACACGCGCAAGCGCTCCGACAGGCAATCCGTCAGTCAACGGATCAGC
ATAATCAACCCCTTCAAGCGATCCCACGGCGCCACCAACTCCATCTTCACCATCCAGCAATCCGACAGCAAAGGC
CAAATAGTGGGTGAAGAAGACGAAAATCTCGACGACGACACGGCTACGATTAACAGCCGCACAACCAGCCACTCC
CGCGGCGGCCGAAGCGAGAGACGCCGCAGCTTCTTCGGCGACAAGACCTACAAGCACGGCTCCTCGCCGTCCGTG
GCCCATGAATCCCAGACCTCATTGAACACGCACAATGTCCCCCACGACACGGCTGCCCGCTCCCACGACGGCCGC
AGTCGCGCCGACTCCCAGCAGCGCGGCCCTGTTGCCACCGGTGCAGCCACAGACCGGATTGCGCCCGCCTCCAGT
GGTGGGTGGTCGACGCTCCCGTCTACACGCGATTATTCGCGGCCTGCCACACGTGATAGTAATGTGATGACTCTG
ACGACCACGAATGGCACGGCGCCGTTGTCCCCTGTGCTCAATAATAGTAATAGCGGGATGCGGGACTCGGTGTTT
CGTCGTTTCAGTATGCTCAAGGGTGTCGGCCGCAAGAGCAGTCGGATGGATTTCAAAGCTAATGGTGTGCTGCCG
GAGGAGTAA
Transcript >Pro_DTO377G3_2|g6192.t1
ATGCCCTGGCGGCCGCTGCCTCGCATCGCATTTGCCGTTGCCATATACCCTTTCAACCCGTCCTCCCCCGCAGAT
CTACCATTGGAGCTTGGCGATGAGCTTTACATAATTGAGCAAGGAGGGACGGACGGCGAATGGTGTCGAGGCTAT
CTAGTCGCGCCGCCGTCGTTACTGGCCGGCTTGACAAGCATCAAAGGCCAAACTCTCGAAGCTCGTGTATTCTCG
GGTATCTTCCCGCGGAACTGCGTTGAGATTAGAGAGGTGCTAGGCGACGGCGATGGATATAAAGCACTACTAAAT
GCTGACCGGAAAAGCATTGATCGACTGACCTTGTCCGGCTGGGATGGAGAATTCCTGTCCCGAAATAGTCTGGCT
TATTCCGTCAGTGACTTTCAGGCTGTTGCCGAGGTGTCGGACGTCGTCCTTGCGAAAAAGGGGAAGCCTTCCCAG
ATTATCATTCACAAGACCGATGGGTCAGACCAGGCAAGTCCGCGATGGCGAACAGGCTCGATCCCGCATACGCCT
GTCTCATTTGCTCCTCGCGACCCTGATGCGCCGAAGCCGCCTGCCCCCGTCCCGATGCTTAAGATCGGCGATGAA
ACTCCGACCTCTCTCACAGAGCCCCTAGTGGATGAAATCGCATCGTGTCTGCGCGAATGGCATTCGACTAATTTG
CATGAATTACTTTTGGCACGCCGGTATGATGTATTGGAGGAAATGTCAACCGTGGTACAAGAGCTGGACTTTGCG
AGACGACAATTACTACACAATGTTCTGACTGGAAAGGAGAAGGAAGCATTGCGGAACGACACAGTCTGGAAACTT
GTCAAGGCAAACAAAATGCTTAGCGGGGACGTGATTGTTCGCGATCCGGAGCAGAGAGGCCGTTTGCTAACGGGT
GATGACTCTGCTATCCAATTGGCGAAGCTGCAGTCCGAGATGAGTATGCTCGAATCCAGTCCCACCCAGACATCC
GATGCTACTGCACTCCATCATTTGCTGCTGGAGATCAACGCGGTATCAGGGAATGCACCGGGGCAAGTGACTATC
GGAATACAGCTGTTCTCCCGGTCAGACGCTGGTTCACTCAGTCCATTATCTGAGACCTATAGCTTAGATATTCCG
TCTCCTGATAAATTCGTCAACATGAGCCAAAGCAGTAGACTGAAGACACTGTTCACCGAATTGGCCGCAACAGAC
ATCGGAGATGGATCTCCGAATGGGCGGCAGCTTTATCTAGTTGCTTGGGTTCGTGCCCCAGAGACCCGGTCCACA
GCTGATACCACTCCTGTGTCGAGGCCATCAATCTCGCGAGACACCCCAACCCCAACCAAGGCCACGACAAATGGT
AGTGTTCAACCTTCGGCCAAGGGTAGTTTGAAAACGCGACGCAGCATGATGTGGACACCCAAGCAACGCGGACCG
AGCTTGGATCAGCCACCTAGGCCCATTACTCAAGGAATTCCACGAACATCGAGCAGTGCGTCCAGCGTCAAAGAC
ACAACCACCCCTCAACCCGCACCAACAAAGGAGGTCTCGGCGATCCGTACTGTTGGCGTTGGGATCTTGGAGATA
TCGCCGATTCTTCGACAGGATAAGGACACTGAACAAGTGATCAACATTTGGTCGCCCCGTCGAGACGGCGAAGAC
GGCGAGGGGCTGACGGATGGCTTTGACAAGTTGATCCGCGCCTTGCTTCCTAGTCCCACCGGCCGGTATGTACGT
GCCGACCCCGCAGCACGTTTACACCTCCATCTGCGCCCCTTTGCCAGTTGCGATGCGGAATTCCTGATTCGTCAG
AATCCTACTATATTGCACGATGTCATACAGACACAGCGCATTGGATTCTCCAAGGCTCCTACGAAGCCAAGATCC
GATATCTACGTTACACTCTGTCAGGCGGTATTCCCCACAGATGCTCTCCTGTCTCACCCGCAAGCAGGTCAAATT
CCTCTGCAGGCGGCCAGCGGACTTCACAATCTTCAACTCACTCTTGAAGTACGTGATTCTAAAGGAGCTCGGATA
GACAAATGTGTCTTCCCTTCGTCATCCAAAACTTCAAACACGGCATGGCGCACTACCATCGCCCAGCGCGGCACA
CCTTGGAACCAGACCATCCGCCTCAAGATCCCCACAGAACAAATCCCTGGCTCGCACATAGTGATGAGTGTTGCA
GATGCGCCAGAATTTCCCTTTGCTCTTGCCTGGATGCCCCTTTGGGATCAGCAAGCTTTCATTAGAGATGGGCAT
CATTCTCTGCTGTTGCATGCTTATGACAAGCAGACATCCAGCATTGAGAATGGAAAGGGTGCTTATCTGAACCTC
CCATGGAGCGCGCTCGGCAAGAATGAATCCGCCAAAGATGAAGCTGTGACGGGTCCATTGGCCACTTTGCACCTT
GAAACCCATCTTTGCAGCACAGAGTACTCCCAGGATCAAGTCATTCTGAGTCTTCTCAACTGGCGAGAGCGGCCC
GTGGACGAGGTCTTGGATACCCTGAAACGTTTACTTTTTGTTCCCGAAATCGAGATTGTGAAACAACTAAGTGGT
GTCTTCGACGCGCTGTTCGGAATCCTGGTGGAGAATGCTGGTAATGAAGAATACGAGAACTTGATCTTCAACAAC
CTGGTCACTGTTCTGGGAATTGTCCATGATCGACGATACAACCTAGGCCCGCTGGTCGACCGGTACGCCGATGAG
CAGTTCAACTTCCCATTCGTCACCCCGTGCCTTATTCGAAGCTACTTGCGCCTCTTAAACGCAGGGACCGACGGT
ACGCAATCTCGCAATCTCCGTGCCGCCTTCAAGGTGGGACGCCATCTGTTAAAATTCATCATCAAGGCTCGCGAG
CAGCAAAAGGCCAAGGAGGAAGGTATTGGCATCACCACGGTGCAATCCACCTTCAACAGAGACATGCGTACCATT
TTCAAGGCTATGGAGACTTTGATGAGAAACTCGTCGCCGGCTTTGGTGGGCAGCAAAACACTGGTAGTTCAACAT
TTCCATACGTGGCTACCTGAGCTCTCCAACGTCCTGAGCAAGGATGAAATAATTATGATCGCTCTGAGTTTCATG
GATTCATGCAAGGATGTCACCGGCATGTTGATACTCTATAAGCTAGTTCTCATTCAGAATTATACTCTGTTTGAT
GTTTTCGCCTCCGGCGACGAGAGACGAACATTGATCTCCAGCTGTATTGGCTGGTTGACTCCATACTGGGGTTCC
ACCTCAGGCGTCTCGGATTTGTATCGAGATCAGGTGCGACTGAGCAACTCAATCGTGGCTCAATTGCTCAGTCAG
CCTGATCCTCTGCTTTATGGATTCATGCCAGCTATCGTCGCCTCTTACTGTGCTATCTCCACTGAGGGAGTAGAG
GAGTCGGAGTATCTTTCTTTGCTTTTCAGCAAGGCGTTCCCCTTCCAGATGAAGACTGCCAAGACCCCTCAAAGC
TTCGATGAGTCTTTGGTGGAACTGTCTGCGCTCATGGCTGCCATTGCCAAGATCGCGTCTCCCAAGCTACCCAAC
TTGAAAGAATTGGAGCTTGCACTATTTGTTGCTCAGACCCTTGAGGCTCACAACTCCATCCTCGACTGCGAGGCT
TATCCCGAGACCTGGTTCAGTATTCATGTGTACAACCATCGCGCGACTATCAAGAGTCTTGAACATATTGCAGTG
TTGCTAATTGATAAACTCCTTCCGGCACCGGATGATGCCGACACATTCGATACCAAGCTGTGGGAGTCGTTTTTC
ACGACTCTGTTAAAGGTGATCTCTAGTGATGTCCTTGCGCTCGAAACTTTCCCCGAGCAGAAGCGCCGCGCTGTC
TGGAAGATCGCCGGCGATGTGCGCGAGCAAGGTGCGGACTTATTGCAATCTACCTGGGAAGCCATTGGTTGGGAG
ACTACGGACGACGAGAGGGAGCGATTCAATCTGAAAAGGCTGGGCGGTTATCAGGTCCAGTATGTTCCCGGCCTG
GTGCCTCCCATCATTGGTCTGTGTCTCAGTGTCCACGAGGGGCTGCGACATGTTGCTGTTCAAATACTGCAGACG
ATGATTCTGAGTGAATGGGATCTGAACCAAGATATCTCCATTATTGAAACGGAGATCATCTCTAGCCTGGATACG
CTCTTCAAGTCCAAGCAGATGAACGAGAGCGTCAGCCAGAAGGTTTTCATCGGCGAGCTGTTGGATCTGTTCGAG
AGGGAAACTATATCCGATGATCTGTTGTCGAATGCTGTCAAGAGTCTGGTCGGGACAGTCGATGAGCTCTTGGAT
CTTTTGGTGGCTTCTCAGAGCGGTGCCTCAACCCAAAGTTTGCACGCTCTGAAATTAATGGAATATATGAAGGAC
ATGGGTCGCGAGGACATCTTTATTCGTTACGTTCATGAACTTGCGGATGCTCAGGCTGCGGCAGGTAACTTCACT
GAAGCAGGTCTTGCCCTTCAGTTCCATGCCGATCTCTACGAATGGGATCCCATCAAGCCTATGCCGGAGCTACTC
AGGCCCGCATTCCCAGCCCAGAATGCATTCGAACGGAGAGAGGCTTTATACTTCTCCATTATCCAGAACTTCGAA
AATGCCATGGCCTGGGGCCCCGCGTTAGCTTGCTATAAGGAGCTCGCGGTGCACTATGAGCACACGACAATGGAC
TTCGCCAAGCTCTCCCGAGCCCAAAGCTCCATGGCTCGAATTTATGACTACATCGCCAAGGGCAACAAACAATTC
CCGCGTTACTTCCGTGTGGTCTACAAGGGTCTTGGGTTTCCTCCCGGCCTACGCGATAAGGAGTTCATATTCGAA
GCGTGTCCGACTGAACGCATGGCCTCTTTTGTGGATCGTATGCAGCGGGAACACCCTACTGCGCAGGTCATGTCT
ACTGGCGAGATACCTGACTATGAGGGCCAGTTCCTTCAGATCAGCGCCGTTAGCGCATACCGCGATGTGTCTCAT
CCTGTCTACCAGCGCCCCAAGGTTCCGTCTTCTGTCCGCGAGCACCTGTTGATCTCGGATCCATCTCGCTTCTCT
TCCACTTCGCGACGACACACGACCAGCTCGGATGTCCGGGAGCACTTCGTTCAAAAGCTCGTCTTCACTGTCTCG
GAAGCATTTCCGAATATCCTCCGTCGTAGTGAGGTCATTTCTGCCGAAGAGGTTACGCTCTCGCCTCTGCAGACT
GCTATTGAGCGCACGTGGCGCAAAACACAGGAGCTTCAGCTTATTGGACGCCGTGCTGCGTCGGGTGAGGATTCT
GGTCTATCTAATCTGACCGATGCCCTAGAATCACTGCTTGACCACAGCTCGTCAACCTCTAACTGTGTGGCATCG
TATCGGGTATTCCTATCCGATGCGGAGATGGCAAGGAACAAGCTGCTTGAGGAACTTGATGAAGACGGTGAAATA
GTACAAGCAACACAGCAGCCGGTGGACCCAATGGAGACGGCGCTCTTCGTTGCACTCGTCGACCACGCCTTGGCT
ATCAAACAAGCATTGGCTCTTTACCAGCGCCCCGCTCAGCAAGCTACCCAAGCCGAACTACTCCGACGCTTTGAA
GATGTCTTCGAGCCCGAGTTAGGTTCTCTCGTCCCTGCTCCGCAGGAGTATTCATCACCTACGCCTACACAAACA
GCTCGCCAGTCCCCCTCCTCGAGCGACAATCGTCGAATGCCACCTATCCAGCGAGTCGGCAGTTCAGAACAAGAC
CTCAACCGCGCAGCCCGAAACAATGCCCACACGCGCAAGCGCTCCGACAGGCAATCCGTCAGTCAACGGATCAGC
ATAATCAACCCCTTCAAGCGATCCCACGGCGCCACCAACTCCATCTTCACCATCCAGCAATCCGACAGCAAAGGC
CAAATAGTGGGTGAAGAAGACGAAAATCTCGACGACGACACGGCTACGATTAACAGCCGCACAACCAGCCACTCC
CGCGGCGGCCGAAGCGAGAGACGCCGCAGCTTCTTCGGCGACAAGACCTACAAGCACGGCTCCTCGCCGTCCGTG
GCCCATGAATCCCAGACCTCATTGAACACGCACAATGTCCCCCACGACACGGCTGCCCGCTCCCACGACGGCCGC
AGTCGCGCCGACTCCCAGCAGCGCGGCCCTGTTGCCACCGGTGCAGCCACAGACCGGATTGCGCCCGCCTCCAGT
GGTGGGTGGTCGACGCTCCCGTCTACACGCGATTATTCGCGGCCTGCCACACGTGATAGTAATGTGATGACTCTG
ACGACCACGAATGGCACGGCGCCGTTGTCCCCTGTGCTCAATAATAGTAATAGCGGGATGCGGGACTCGGTGTTT
CGTCGTTTCAGTATGCTCAAGGGTGTCGGCCGCAAGAGCAGTCGGATGGATTTCAAAGCTAATGGTGTGCTGCCG
GAGGAGTAA
Gene >Pro_DTO377G3_2|g6192.t1
ATGCCCTGGCGGCCGCTGCCTCGCATCGCATTTGCCGTTGCCATATACCCTTTCAACCCGTCCTCCCCCGCAGAT
CTACCATTGGAGCTTGGCGATGAGCTTTACATAATTGAGCAAGGAGGGACGGACGGCGAATGGTGTCGAGGCTAT
CTAGTCGCGCCGCCGTCGTTACTGGCCGGCTTGACAAGCATCAAAGGCCAAACTCTCGAAGCTCGTGTATTCTCG
GGTATCTTCCCGCGGAACTGCGTTGAGATTAGAGAGGTGCTAGGCGACGGCGATGGATATAAAGCACTACTAAAT
GCTGACCGGAAAAGCATTGATCGACTGACCTTGTCCGGCTGGGATGGAGAATTCCTGTCCCGAAATAGTCTGGCT
TATTCCGTCAGTGACTTTCAGGCTGTTGCCGAGGTGTCGGACGTCGTCCTTGCGAAAAAGGGGAAGCCTTCCCAG
ATTATCATTCACAAGACCGATGGGTCAGACCAGGCAAGTCCGCGATGGCGAACAGGCTCGATCCCGCATACGCCT
GTCTCATTTGCTCCTCGCGACCCTGATGCGCCGAAGCCGCCTGCCCCCGTCCCGATGCTTAAGATCGGCGATGAA
ACTCCGACCTCTCTCACAGAGCCCCTAGTGGATGAAATCGCATCGTGTCTGCGCGAATGGCATTCGACTAATTTG
CATGAATTACTTTTGGCACGCCGGTATGATGTATTGGAGGAAATGTCAACCGTGGTACAAGAGCTGGACTTTGCG
AGACGACAATTACTACACAATGTTCTGACTGGAAAGGAGAAGGAAGCATTGCGGAACGACACAGTCTGGAAACTT
GTCAAGGCAAACAAAATGCTTAGCGGGGACGTGATTGTTCGCGATCCGGAGCAGAGAGGCCGTTTGCTAACGGGT
GATGACTCTGCTATCCAATTGGCGAAGCTGCAGTCCGAGATGAGTATGCTCGAATCCAGTCCCACCCAGACATCC
GATGCTACTGCACTCCATCATTTGCTGCTGGAGATCAACGCGGTATCAGGGAATGCACCGGGGCAAGTGACTATC
GGAATACAGCTGTTCTCCCGGTCAGACGCTGGTTCACTCAGTCCATTATCTGAGACCTATAGCTTAGATATTCCG
TCTCCTGATAAATTCGTCAACATGAGCCAAAGCAGTAGACTGAAGACACTGTTCACCGAATTGGCCGCAACAGAC
ATCGGAGATGGATCTCCGAATGGGCGGCAGCTTTATCTAGTTGCTTGGGTTCGTGCCCCAGAGACCCGGTCCACA
GCTGATACCACTCCTGTGTCGAGGCCATCAATCTCGCGAGACACCCCAACCCCAACCAAGGCCACGACAAATGGT
AGTGTTCAACCTTCGGCCAAGGGTAGTTTGAAAACGCGACGCAGCATGATGTGGACACCCAAGCAACGCGGACCG
AGCTTGGATCAGCCACCTAGGCCCATTACTCAAGGAATTCCACGAACATCGAGCAGTGCGTCCAGCGTCAAAGAC
ACAACCACCCCTCAACCCGCACCAACAAAGGAGGTCTCGGCGATCCGTACTGTTGGCGTTGGGATCTTGGAGATA
TCGCCGATTCTTCGACAGGATAAGGACACTGAACAAGTGATCAACATTTGGTCGCCCCGTCGAGACGGCGAAGAC
GGCGAGGGGCTGACGGATGGCTTTGACAAGTTGATCCGCGCCTTGCTTCCTAGTCCCACCGGCCGGTATGTACGT
GCCGACCCCGCAGCACGTTTACACCTCCATCTGCGCCCCTTTGCCAGTTGCGATGCGGAATTCCTGATTCGTCAG
AATCCTACTATATTGCACGATGTCATACAGACACAGCGCATTGGATTCTCCAAGGCTCCTACGAAGCCAAGATCC
GATATCTACGTTACACTCTGTCAGGCGGTATTCCCCACAGATGCTCTCCTGTCTCACCCGCAAGCAGGTCAAATT
CCTCTGCAGGCGGCCAGCGGACTTCACAATCTTCAACTCACTCTTGAAGTACGTGATTCTAAAGGAGCTCGGATA
GACAAATGTGTCTTCCCTTCGTCATCCAAAACTTCAAACACGGCATGGCGCACTACCATCGCCCAGCGCGGCACA
CCTTGGAACCAGACCATCCGCCTCAAGATCCCCACAGAACAAATCCCTGGCTCGCACATAGTGATGAGTGTTGCA
GATGCGCCAGAATTTCCCTTTGCTCTTGCCTGGATGCCCCTTTGGGATCAGCAAGCTTTCATTAGAGATGGGCAT
CATTCTCTGCTGTTGCATGCTTATGACAAGCAGACATCCAGCATTGAGAATGGAAAGGGTGCTTATCTGAACCTC
CCATGGAGCGCGCTCGGCAAGAATGAATCCGCCAAAGATGAAGCTGTGACGGGTCCATTGGCCACTTTGCACCTT
GAAACCCATCTTTGCAGCACAGAGTACTCCCAGGATCAAGTCATTCTGAGTCTTCTCAACTGGCGAGAGCGGCCC
GTGGACGAGGTCTTGGATACCCTGAAACGTTTACTTTTTGTTCCCGAAATCGAGATTGTGAAACAACTAAGTGGT
GTCTTCGACGCGCTGTTCGGAATCCTGGTGGAGAATGCTGGTAATGAAGAATACGAGAACTTGATCTTCAACAAC
CTGGTCACTGTTCTGGGAATTGTCCATGATCGACGATACAACCTAGGCCCGCTGGTCGACCGGTACGCCGATGAG
CAGTTCAACTTCCCATTCGTCACCCCGTGCCTTATTCGAAGCTACTTGCGCCTCTTAAACGCAGGGACCGACGGT
ACGCAATCTCGCAATCTCCGTGCCGCCTTCAAGGTGGGACGCCATCTGTTAAAATTCATCATCAAGGCTCGCGAG
CAGCAAAAGGCCAAGGAGGAAGGTATTGGCATCACCACGGTGCAATCCACCTTCAACAGAGACATGCGTACCATT
TTCAAGGCTATGGAGACTTTGATGAGAAACTCGTCGCCGGCTTTGGTGGGCAGCAAAACACTGGTAGTTCAACAT
TTCCATACGTGGCTACCTGAGCTCTCCAACGTCCTGAGCAAGGATGAAATAATTATGATCGCTCTGAGTTTCATG
GATTCATGCAAGGATGTCACCGGCATGTTGATACTCTATAAGCTAGTTCTCATTCAGAATTATACTCTGTTTGAT
GTTTTCGCCTCCGGCGACGAGAGACGAACATTGATCTCCAGCTGTATTGGCTGGTTGACTCCATACTGGGGTTCC
ACCTCAGGCGTCTCGGATTTGTATCGAGATCAGGTGCGACTGAGCAACTCAATCGTGGCTCAATTGCTCAGTCAG
CCTGATCCTCTGCTTTATGGATTCATGCCAGCTATCGTCGCCTCTTACTGTGCTATCTCCACTGAGGGAGTAGAG
GAGTCGGAGTATCTTTCTTTGCTTTTCAGCAAGGCGTTCCCCTTCCAGATGAAGACTGCCAAGACCCCTCAAAGC
TTCGATGAGTCTTTGGTGGAACTGTCTGCGCTCATGGCTGCCATTGCCAAGATCGCGTCTCCCAAGCTACCCAAC
TTGAAAGAATTGGAGCTTGCACTATTTGTTGCTCAGACCCTTGAGGCTCACAACTCCATCCTCGACTGCGAGGCT
TATCCCGAGACCTGGTTCAGTATTCATGTGTACAACCATCGCGCGACTATCAAGAGTCTTGAACATATTGCAGTG
TTGCTAATTGATAAACTCCTTCCGGCACCGGATGATGCCGACACATTCGATACCAAGCTGTGGGAGTCGTTTTTC
ACGACTCTGTTAAAGGTGATCTCTAGTGATGTCCTTGCGCTCGAAACTTTCCCCGAGCAGAAGCGCCGCGCTGTC
TGGAAGATCGCCGGCGATGTGCGCGAGCAAGGTGCGGACTTATTGCAATCTACCTGGGAAGCCATTGGTTGGGAG
ACTACGGACGACGAGAGGGAGCGATTCAATCTGAAAAGGCTGGGCGGTTATCAGGTCCAGTATGTTCCCGGCCTG
GTGCCTCCCATCATTGGTCTGTGTCTCAGTGTCCACGAGGGGCTGCGACATGTTGCTGTTCAAATACTGCAGACG
ATGATTCTGAGTGAATGGGATCTGAACCAAGATATCTCCATTATTGAAACGGAGATCATCTCTAGCCTGGATACG
CTCTTCAAGTCCAAGCAGATGAACGAGAGCGTCAGCCAGAAGGTTTTCATCGGCGAGCTGTTGGATCTGTTCGAG
AGGGAAACTATATCCGATGATCTGTTGTCGAATGCTGTCAAGAGTCTGGTCGGGACAGTCGATGAGCTCTTGGAT
CTTTTGGTGGCTTCTCAGAGCGGTGCCTCAACCCAAAGTTTGCACGCTCTGAAATTAATGGAATATATGAAGGAC
ATGGGTCGCGAGGACATCTTTATTCGTTACGTTCATGAACTTGCGGATGCTCAGGCTGCGGCAGGTAACTTCACT
GAAGCAGGTCTTGCCCTTCAGTTCCATGCCGATCTCTACGAATGGGATCCCATCAAGCCTATGCCGGAGCTACTC
AGGCCCGCATTCCCAGCCCAGAATGCATTCGAACGGAGAGAGGCTTTATACTTCTCCATTATCCAGAACTTCGAA
AATGCCATGGCCTGGGGCCCCGCGTTAGCTTGCTATAAGGAGCTCGCGGTGCACTATGAGCACACGACAATGGAC
TTCGCCAAGCTCTCCCGAGCCCAAAGCTCCATGGCTCGAATTTATGACTACATCGCCAAGGGCAACAAACAATTC
CCGCGTTACTTCCGTGTGGTCTACAAGGGTCTTGGGTTTCCTCCCGGCCTACGCGATAAGGAGTTCATATTCGAA
GCGTGTCCGACTGAACGCATGGCCTCTTTTGTGGATCGTATGCAGCGGGAACACCCTACTGCGCAGGTCATGTCT
ACTGGCGAGATACCTGACTATGAGGGCCAGTTCCTTCAGATCAGCGCCGTTAGCGCATACCGCGATGTGTCTCAT
CCTGTCTACCAGCGCCCCAAGGTTCCGTCTTCTGTCCGCGAGCACCTGTTGATCTCGGATCCATCTCGCTTCTCT
TCCACTTCGCGACGACACACGACCAGCTCGGATGTCCGGGAGCACTTCGTTCAAAAGCTCGTCTTCACTGTCTCG
GAAGCATTTCCGAATATCCTCCGTCGTAGTGAGGTCATTTCTGCCGAAGAGGTTACGCTCTCGCCTCTGCAGACT
GCTATTGAGCGCACGTGGCGCAAAACACAGGAGCTTCAGCTTATTGGACGCCGTGCTGCGTCGGGTGAGGATTCT
GGTCTATCTAATCTGACCGATGCCCTAGAATCACTGCTTGACCACAGCTCGTCAACCTCTAACTGTGTGGCATCG
TATCGGGTATTCCTATCCGATGCGGAGATGGCAAGGAACAAGCTGCTTGAGGAACTTGATGAAGACGGTGAAATA
GTACAAGCAACACAGCAGCCGGTGGACCCAATGGAGACGGCGCTCTTCGTTGCACTCGTCGACCACGCCTTGGCT
ATCAAACAAGCATTGGCTCTTTACCAGCGCCCCGCTCAGCAAGCTACCCAAGCCGAACTACTCCGACGCTTTGAA
GATGTCTTCGAGCCCGAGTTAGGTTCTCTCGTCCCTGCTCCGCAGGAGTATTCATCACCTACGCCTACACAAACA
GCTCGCCAGTCCCCCTCCTCGAGCGACAATCGTCGAATGCCACCTATCCAGCGAGTCGGCAGTTCAGAACAAGAC
CTCAACCGCGCAGCCCGAAACAATGCCCACACGCGCAAGCGCTCCGACAGGCAATCCGTCAGTCAACGGATCAGC
ATAATCAACCCCTTCAAGCGATCCCACGGCGCCACCAACTCCATCTTCACCATCCAGCAATCCGACAGCAAAGGC
CAAATAGTGGGTGAAGAAGACGAAAATCTCGACGACGACACGGCTACGATTAACAGCCGCACAACCAGCCACTCC
CGCGGCGGCCGAAGCGAGAGACGCCGCAGCTTCTTCGGCGACAAGACCTACAAGCACGGCTCCTCGCCGTCCGTG
GCCCATGAATCCCAGACCTCATTGAACACGCACAATGTCCCCCACGACACGGCTGCCCGCTCCCACGACGGCCGC
AGTCGCGCCGACTCCCAGCAGCGCGGCCCTGTTGCCACCGGTGCAGCCACAGACCGGATTGCGCCCGCCTCCAGT
GGTGGGTGGTCGACGCTCCCGTCTACACGCGATTATTCGCGGCCTGCCACACGTGATAGTAATGTGATGACTCTG
ACGACCACGAATGGCACGGCGCCGTTGTCCCCTGTGCTCAATAATAGTAATAGCGGGATGCGGGACTCGGTGTTT
CGTCGTTTCAGTATGCTCAAGGGTGTCGGCCGCAAGAGCAGTCGGATGGATTTCAAAGCTAATGGTGTGCTGCCG
GAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail