Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6189.t1
Gene name
Locationscaffold_16:181208..184020
Strand-
Gene length (bp)2812
Transcript length (bp)2550
Coding sequence length (bp)2550
Protein length (aa) 850

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 1.5E-10 1 39
PF03105 SPX SPX domain 1.2E-24 43 265
PF00939 Na_sulph_symp Sodium:sulfate symporter transmembrane region 1.7E-31 389 841
PF03600 CitMHS Citrate transporter 6.5E-23 422 782

GO

GO Term Description Terminal node
GO:0006814 sodium ion transport Yes
GO:0005215 transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0031224 intrinsic component of membrane No
GO:0015672 monovalent inorganic cation transport No
GO:0051179 localization No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0044425 membrane part No
GO:0030001 metal ion transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 382 404 22
2 417 448 31
3 468 490 22
4 523 545 22
5 560 582 22
6 595 617 22
7 637 656 19
8 663 685 22
9 695 717 22
10 730 752 22
11 778 800 22
12 821 843 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6189.t1
MKFSHSIQFNAVPDWSSNYIAYSNLKKLIYTLEKQVNRVEGPSTTDVESAPLLGAEPSNPDAIFKRALDVEMDKI
CSFYQKKEAEIFELADELIKDAGVYLSETDGVNMDPVSETIIKASSRRGNNVSAPRRRSSAVSNDSMADDEGEGG
DSDDDRSPAAVSHRPRVSQSIDGESGTEDHYGDLVDSSYFGPATSREPHESYLNDEDFRALYNTGISLKKRLIEC
YVSLCELRSFIELNKTGFAKALKKYDKTLDRSLRRDYLATVVHPAPPFTESTMAEIDRHIENVEGVYAGIVTKND
KQSARRELRLHLREHVVWERNTVWREMIEIERRAQAANVGIRRTLLGGDDPASSRRQGDKNEIRTQEMSTPLGRF
QFPLWLCSLSFGTLIFSIAIFGVMLSLNVMETPEEQNCLAMLVLVSILWATEAIPLFVTSLLIPFLVVTLGIMRS
DEEPHTRLGPKESVGKVFAAMWTPVIMLLLGGFSIAAALSKYDIARRMAMFVLSKAGSKPSVMLLTNMFVSMFLS
MWISNVASPVLCYSIIQPLLRNMPPESDFAKALVLGIALAANVGGAASPIASPQNIIALQNMQPNISWGTWFFIA
LPVCIISILLIWVLLLVTFRPGRNSTVMPIRPVKDRWTGMQSFISIVTLLTIVLWCASHQLEHIFGDMGVIAIIP
LVIFFGTGILNKEDFNNFLWTIIILAAGGLCLGKAVTSSGLLHTIAMGITARVENLSLYSVLLVFCSLILVMATF
ISHTVAALIILPLVRQIGVSMENPHPNLLVMASALMCSVAMALPTSGFPNMTAIMTEVPQTGQRYLQVHHFLTRG
IPASLMCFVVIVTIGYGLMYVAGL*
Coding >Pro_DTO377G3_2|g6189.t1
ATGAAGTTCTCGCATAGTATTCAGTTTAATGCTGTGCCCGATTGGAGCTCGAACTACATCGCGTACAGCAATTTG
AAGAAATTGATCTACACCCTCGAGAAACAGGTCAATCGCGTTGAGGGACCGTCTACCACAGATGTAGAGTCCGCT
CCGCTGCTGGGCGCTGAGCCGAGCAACCCGGATGCAATCTTTAAAAGGGCTCTTGACGTTGAGATGGATAAGATC
TGTTCCTTCTATCAGAAGAAGGAGGCGGAGATTTTTGAACTCGCAGATGAGCTCATAAAAGACGCTGGTGTATAT
CTTTCCGAAACGGACGGTGTTAATATGGACCCCGTCAGCGAGACAATCATAAAGGCAAGCTCCCGCCGCGGCAAC
AATGTCTCGGCTCCGCGCCGGCGGTCTAGTGCTGTGAGCAATGACTCGATGGCGGACGATGAAGGAGAAGGTGGT
GATAGCGACGACGATCGTTCCCCGGCGGCCGTCTCACATCGCCCGAGAGTGTCGCAGTCGATCGATGGCGAGTCT
GGCACGGAGGACCACTACGGTGATTTGGTAGACTCTTCCTACTTTGGACCGGCGACCAGCCGAGAACCGCACGAG
TCGTACTTGAACGACGAGGATTTCCGCGCTCTTTATAATACCGGTATATCGTTAAAAAAGCGCCTGATCGAATGC
TACGTCTCACTCTGCGAACTTCGCTCCTTCATCGAGCTGAACAAGACTGGCTTCGCCAAGGCCCTGAAGAAGTAT
GACAAAACCTTGGACCGCAGCCTGCGCCGAGACTACCTAGCCACTGTTGTCCATCCCGCACCACCTTTCACTGAA
AGTACCATGGCTGAAATCGATCGCCATATTGAGAACGTGGAGGGTGTGTACGCGGGCATCGTCACGAAGAACGAT
AAACAGTCTGCTAGGCGCGAGCTGCGTCTGCATCTGCGTGAGCATGTCGTTTGGGAGCGGAACACTGTCTGGCGC
GAGATGATCGAAATCGAACGACGTGCGCAGGCCGCCAATGTTGGTATTCGCCGGACCCTCCTGGGCGGCGATGAC
CCGGCTAGCTCCCGGCGCCAGGGCGACAAGAACGAGATCCGCACCCAGGAGATGTCAACCCCGCTTGGTCGATTC
CAGTTTCCGTTATGGCTCTGTAGCTTGAGCTTTGGTACGCTGATATTTAGTATCGCCATATTCGGCGTAATGCTT
TCCTTGAACGTGATGGAAACTCCCGAGGAGCAGAACTGCTTGGCTATGCTAGTCCTCGTTAGTATCTTGTGGGCC
ACTGAGGCCATTCCGCTGTTTGTCACTTCGCTTCTTATCCCATTCCTAGTCGTGACTCTAGGCATCATGCGGTCA
GACGAAGAGCCGCACACGCGGCTGGGACCCAAGGAATCAGTCGGCAAGGTGTTCGCGGCGATGTGGACTCCTGTG
ATTATGCTACTCCTGGGTGGTTTCTCAATCGCAGCGGCGCTGTCCAAGTACGACATCGCACGGCGCATGGCCATG
TTTGTGCTAAGCAAAGCTGGATCGAAGCCATCTGTGATGTTATTGACCAACATGTTTGTGAGTATGTTCTTGAGT
ATGTGGATCAGCAATGTTGCGTCCCCTGTGCTCTGCTACTCTATCATCCAGCCTTTGCTGCGCAACATGCCTCCC
GAGTCGGACTTCGCCAAGGCACTCGTGCTGGGTATCGCGTTAGCCGCCAATGTCGGTGGTGCAGCGTCCCCGATT
GCCTCGCCGCAGAATATCATTGCCCTGCAGAACATGCAGCCGAACATCAGCTGGGGCACATGGTTCTTCATCGCA
TTGCCCGTCTGCATCATCTCCATTCTACTCATCTGGGTTCTGCTGCTGGTGACATTCCGCCCGGGCCGCAACTCA
ACCGTGATGCCCATCCGCCCTGTCAAAGACCGCTGGACCGGCATGCAGTCCTTTATCAGCATCGTCACGCTCCTG
ACGATCGTCCTCTGGTGCGCCAGCCACCAGCTCGAGCACATTTTCGGCGACATGGGCGTCATCGCCATCATCCCT
CTCGTCATCTTCTTCGGCACCGGCATCCTCAACAAAGAGGACTTCAACAACTTCCTCTGGACGATCATAATCCTC
GCCGCCGGTGGTCTGTGTCTGGGCAAGGCCGTCACTTCATCGGGCTTGCTGCACACCATCGCCATGGGTATCACC
GCGCGTGTCGAGAACCTCAGCCTATACAGCGTCCTCTTAGTCTTCTGTTCTCTCATCCTTGTCATGGCCACCTTC
ATCTCGCATACCGTCGCCGCCCTTATCATCCTACCGCTTGTCCGCCAGATCGGCGTTAGCATGGAAAATCCTCAC
CCCAACTTGTTGGTCATGGCTAGTGCCTTGATGTGCTCTGTTGCGATGGCATTGCCCACGAGTGGATTCCCTAAT
ATGACTGCTATCATGACTGAAGTACCTCAGACCGGCCAGCGATATCTCCAAGTCCACCATTTCCTGACCCGCGGC
ATCCCGGCCAGTCTCATGTGCTTTGTGGTTATTGTCACAATTGGATACGGACTGATGTATGTTGCGGGTTTGTAG
Transcript >Pro_DTO377G3_2|g6189.t1
ATGAAGTTCTCGCATAGTATTCAGTTTAATGCTGTGCCCGATTGGAGCTCGAACTACATCGCGTACAGCAATTTG
AAGAAATTGATCTACACCCTCGAGAAACAGGTCAATCGCGTTGAGGGACCGTCTACCACAGATGTAGAGTCCGCT
CCGCTGCTGGGCGCTGAGCCGAGCAACCCGGATGCAATCTTTAAAAGGGCTCTTGACGTTGAGATGGATAAGATC
TGTTCCTTCTATCAGAAGAAGGAGGCGGAGATTTTTGAACTCGCAGATGAGCTCATAAAAGACGCTGGTGTATAT
CTTTCCGAAACGGACGGTGTTAATATGGACCCCGTCAGCGAGACAATCATAAAGGCAAGCTCCCGCCGCGGCAAC
AATGTCTCGGCTCCGCGCCGGCGGTCTAGTGCTGTGAGCAATGACTCGATGGCGGACGATGAAGGAGAAGGTGGT
GATAGCGACGACGATCGTTCCCCGGCGGCCGTCTCACATCGCCCGAGAGTGTCGCAGTCGATCGATGGCGAGTCT
GGCACGGAGGACCACTACGGTGATTTGGTAGACTCTTCCTACTTTGGACCGGCGACCAGCCGAGAACCGCACGAG
TCGTACTTGAACGACGAGGATTTCCGCGCTCTTTATAATACCGGTATATCGTTAAAAAAGCGCCTGATCGAATGC
TACGTCTCACTCTGCGAACTTCGCTCCTTCATCGAGCTGAACAAGACTGGCTTCGCCAAGGCCCTGAAGAAGTAT
GACAAAACCTTGGACCGCAGCCTGCGCCGAGACTACCTAGCCACTGTTGTCCATCCCGCACCACCTTTCACTGAA
AGTACCATGGCTGAAATCGATCGCCATATTGAGAACGTGGAGGGTGTGTACGCGGGCATCGTCACGAAGAACGAT
AAACAGTCTGCTAGGCGCGAGCTGCGTCTGCATCTGCGTGAGCATGTCGTTTGGGAGCGGAACACTGTCTGGCGC
GAGATGATCGAAATCGAACGACGTGCGCAGGCCGCCAATGTTGGTATTCGCCGGACCCTCCTGGGCGGCGATGAC
CCGGCTAGCTCCCGGCGCCAGGGCGACAAGAACGAGATCCGCACCCAGGAGATGTCAACCCCGCTTGGTCGATTC
CAGTTTCCGTTATGGCTCTGTAGCTTGAGCTTTGGTACGCTGATATTTAGTATCGCCATATTCGGCGTAATGCTT
TCCTTGAACGTGATGGAAACTCCCGAGGAGCAGAACTGCTTGGCTATGCTAGTCCTCGTTAGTATCTTGTGGGCC
ACTGAGGCCATTCCGCTGTTTGTCACTTCGCTTCTTATCCCATTCCTAGTCGTGACTCTAGGCATCATGCGGTCA
GACGAAGAGCCGCACACGCGGCTGGGACCCAAGGAATCAGTCGGCAAGGTGTTCGCGGCGATGTGGACTCCTGTG
ATTATGCTACTCCTGGGTGGTTTCTCAATCGCAGCGGCGCTGTCCAAGTACGACATCGCACGGCGCATGGCCATG
TTTGTGCTAAGCAAAGCTGGATCGAAGCCATCTGTGATGTTATTGACCAACATGTTTGTGAGTATGTTCTTGAGT
ATGTGGATCAGCAATGTTGCGTCCCCTGTGCTCTGCTACTCTATCATCCAGCCTTTGCTGCGCAACATGCCTCCC
GAGTCGGACTTCGCCAAGGCACTCGTGCTGGGTATCGCGTTAGCCGCCAATGTCGGTGGTGCAGCGTCCCCGATT
GCCTCGCCGCAGAATATCATTGCCCTGCAGAACATGCAGCCGAACATCAGCTGGGGCACATGGTTCTTCATCGCA
TTGCCCGTCTGCATCATCTCCATTCTACTCATCTGGGTTCTGCTGCTGGTGACATTCCGCCCGGGCCGCAACTCA
ACCGTGATGCCCATCCGCCCTGTCAAAGACCGCTGGACCGGCATGCAGTCCTTTATCAGCATCGTCACGCTCCTG
ACGATCGTCCTCTGGTGCGCCAGCCACCAGCTCGAGCACATTTTCGGCGACATGGGCGTCATCGCCATCATCCCT
CTCGTCATCTTCTTCGGCACCGGCATCCTCAACAAAGAGGACTTCAACAACTTCCTCTGGACGATCATAATCCTC
GCCGCCGGTGGTCTGTGTCTGGGCAAGGCCGTCACTTCATCGGGCTTGCTGCACACCATCGCCATGGGTATCACC
GCGCGTGTCGAGAACCTCAGCCTATACAGCGTCCTCTTAGTCTTCTGTTCTCTCATCCTTGTCATGGCCACCTTC
ATCTCGCATACCGTCGCCGCCCTTATCATCCTACCGCTTGTCCGCCAGATCGGCGTTAGCATGGAAAATCCTCAC
CCCAACTTGTTGGTCATGGCTAGTGCCTTGATGTGCTCTGTTGCGATGGCATTGCCCACGAGTGGATTCCCTAAT
ATGACTGCTATCATGACTGAAGTACCTCAGACCGGCCAGCGATATCTCCAAGTCCACCATTTCCTGACCCGCGGC
ATCCCGGCCAGTCTCATGTGCTTTGTGGTTATTGTCACAATTGGATACGGACTGATGTATGTTGCGGGTTTGTAG
Gene >Pro_DTO377G3_2|g6189.t1
ATGAAGTTCTCGCATAGTATTCAGTTTAATGCTGTGCCCGATTGGAGCTCGAACTACATCGCGTACAGCAATTTG
AAGAAATTGTAAGTTGTTGGGTTGAATATCAGGGCGTCTGTGGCTGGGATAGTGTGTACATGCAGATTCGGGAAT
CTGAATTGGTGTCACATTGCACAGGATCGATGCACCGGCCCGGATGATTATTTCGATGGTGCTAACGTTGCATCG
TGACTAGGATCTACACCCTCGAGAAACAGGTCAATCGCGTTGAGGGACCGTCTACCACAGATGTAGAGTCCGCTC
CGCTGCTGGGCGCTGAGCCGAGCAACCCGGATGCAATCTTTAAAAGGGCTCTTGACGTTGAGATGGATAAGATCT
GTTCCTTCTATCAGAAGAAGGAGGCGGAGATTTTTGAACTCGCAGATGAGCTCATAAAAGACGCTGGTGTATATC
TTTCCGAAACGGACGGTGTTAATATGGACCCCGTCAGCGAGACAATCATAAAGGCAAGCTCCCGCCGCGGCAACA
ATGTCTCGGCTCCGCGCCGGCGGTCTAGTGCTGTGAGCAATGACTCGATGGCGGACGATGAAGGAGAAGGTGGTG
ATAGCGACGACGATCGTTCCCCGGCGGCCGTCTCACATCGCCCGAGAGTGTCGCAGTCGATCGATGGCGAGTCTG
GCACGGAGGACCACTACGGTGATTTGGTAGACTCTTCCTACTTTGGACCGGCGACCAGCCGAGAACCGCACGAGT
CGTACTTGAACGACGAGGATTTCCGCGCTCTTTATAATACCGGTATATCGTTAAAAAAGCGCCTGATCGAATGCT
ACGTCTCACTCTGCGAACTTCGCTCCTTCATCGAGCTGAACAAGACTGGCTTCGCCAAGGCCCTGAAGAAGTATG
ACAAAACCTTGGACCGCAGCCTGCGCCGAGACTACCTAGCCACTGTTGTCCATCCCGCACCACCTTTCACTGAAA
GTACCATGGCTGAAATCGATCGCCATATTGAGAACGTGGAGGGTGTGTACGCGGGCATCGTCACGAAGAACGATA
AACAGTCTGCTAGGCGCGAGCTGCGTCTGCATCTGCGTGAGCATGTCGTTTGGGAGCGGAACACTGTCTGGCGCG
AGATGATCGAAATCGAACGACGTGCGCAGGCCGCCAATGTTGGTATTCGCCGGACCCTCCTGGGCGGCGATGACC
CGGCTAGCTCCCGGCGCCAGGGCGACAAGAACGAGATCCGCACCCAGGAGATGTCAACCCCGCTTGGTCGATTCC
AGTTTCCGTTATGGCTCTGTAGCTTGAGCTTTGGTACGCTGATATTTAGTATCGCCATATTCGGCGTAATGCTTT
CCTTGAACGTGATGGAAACTCCCGAGGAGCAGAACTGCTTGGCTATGCTAGTCCTCGTTAGTATCTTGTGGGCCA
CTGAGGTATGGGTTACTGTTTGTTTATTGACTCACATTGAATGCTAACGTTGAGTGATAGGCCATTCCGCTGTTT
GTCACTTCGCTTCTTATCCCATTCCTAGTCGTGACTCTAGGCATCATGCGGTCAGACGAAGAGCCGCACACGCGG
CTGGGACCCAAGGAATCAGTCGGCAAGGTGTTCGCGGCGATGTGGACTCCTGTGATTATGCTACTCCTGGGTGGT
TTCTCAATCGCAGCGGCGCTGTCCAAGTACGACATCGCACGGCGCATGGCCATGTTTGTGCTAAGCAAAGCTGGA
TCGAAGCCATCTGTGATGTTATTGACCAACATGTTTGTGAGTATGTTCTTGAGTATGTGGATCAGCAATGTTGCG
TCCCCTGTGCTCTGCTACTCTATCATCCAGCCTTTGCTGCGCAACATGCCTCCCGAGTCGGACTTCGCCAAGGCA
CTCGTGCTGGGTATCGCGTTAGCCGCCAATGTCGGTGGTGCAGCGTCCCCGATTGCCTCGCCGCAGAATATCATT
GCCCTGCAGAACATGCAGCCGAACATCAGCTGGGGCACATGGTTCTTCATCGCATTGCCCGTCTGCATCATCTCC
ATTCTACTCATCTGGGTTCTGCTGCTGGTGACATTCCGCCCGGGCCGCAACTCAACCGTGATGCCCATCCGCCCT
GTCAAAGACCGCTGGACCGGCATGCAGTCCTTTATCAGCATCGTCACGCTCCTGACGATCGTCCTCTGGTGCGCC
AGCCACCAGCTCGAGCACATTTTCGGCGACATGGGCGTCATCGCCATCATCCCTCTCGTCATCTTCTTCGGCACC
GGCATCCTCAACAAAGAGGACTTCAACAACTTCCTCTGGACGATCATAATCCTCGCCGCCGGTGGTCTGTGTCTG
GGCAAGGCCGTCACTTCATCGGGCTTGCTGCACACCATCGCCATGGGTATCACCGCGCGTGTCGAGAACCTCAGC
CTATACAGCGTCCTCTTAGTCTTCTGTTCTCTCATCCTTGTCATGGCCACCTTCATCTCGCATACCGTCGCCGCC
CTTATCATCCTACCGCTTGTCCGCCAGATCGGCGTTAGCATGGAAAATCCTCACCCCAACTTGTTGGTCATGGCT
AGTGCCTTGATGTGCTCTGTTGCGATGGCATTGCCCACGAGTGGATTCCCTAATATGAGTATGTCCTTCCTTCAG
TTCACTTGTATCGAGCTCTCTTGCTAACTTGTTTCTCCTAGCTGCTATCATGACTGAAGTACCTCAGACCGGCCA
GCGATATCTCCAAGTCCACCATTTCCTGACCCGCGGCATCCCGGCCAGTCTCATGTGCTTTGTGGTTATTGTCAC
AATTGGATACGGACTGATGTATGTTGCGGGTTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail