Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6184.t1
Gene name
Locationscaffold_16:174087..175125
Strand-
Gene length (bp)1038
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.1E-07 7 258

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 45.88 25.30 66.45
5d_25C Five days - 25 degrees Celsius 45.41 25.00 65.82
7d_25C Seven days - 25 degrees Celsius 39.43 20.80 58.07
10d_25C Ten days - 25 degrees Celsius 39.64 21.10 58.19
7d_15C Seven days - 15 degrees Celsius 49.74 27.89 71.60
7d_30C Seven days - 30 degrees Celsius 42.82 23.28 62.36

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.981076 no
3d_25C 7d_25C 0.647707 no
3d_25C 7d_15C 0.817041 no
3d_25C 7d_30C 0.851897 no
3d_25C 10d_25C 0.655379 no
5d_25C 7d_25C 0.666684 no
5d_25C 7d_15C 0.786514 no
5d_25C 7d_30C 0.873736 no
5d_25C 10d_25C 0.675142 no
7d_25C 7d_15C 0.419730 no
7d_25C 7d_30C 0.826190 no
7d_25C 10d_25C 0.990269 no
7d_15C 7d_30C 0.632945 no
7d_15C 10d_25C 0.431312 no
7d_30C 10d_25C 0.839320 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6184.t1
MATIKTRICMISDTHTSTPHPPQRTDYAYRYPLPKANILLHAGDLTKVGYRVEHEAMIAMLIDADAELKLVIAGN
HDITLDEEYFTTFGYTRHQRPEQLGEESILLSDDNLQTTLRTSSAKTPNTDSLKTYARSIKALWTSESARNAGII
YLEEGIHSFTLSTGAKFTLYASPYQPEFYNWAFAYPRDQDRYNPAPAALPQPQNPIPDYPAIDILLTHGPPAGVL
DQVPPDLSVGCEHLLRAARRARPRLHLFGHIHEGWGAQRGVWDDKAGGDGDGGVRLEDVATDMEEMLENRGAFCD
VSAGADRPLRVGEETLFVNGSIMTVAYEARNAPWVVDLELPVAGA*
Coding >Pro_DTO377G3_2|g6184.t1
ATGGCGACCATCAAGACTCGCATCTGTATGATATCAGACACTCATACAAGCACACCACACCCACCTCAAAGAACC
GATTATGCCTACCGCTATCCACTCCCGAAAGCAAACATCCTCCTCCACGCCGGCGACCTCACAAAGGTGGGGTAC
CGCGTCGAGCACGAAGCAATGATCGCCATGCTCATCGACGCCGACGCCGAGCTCAAGCTCGTAATAGCAGGCAAC
CACGATATAACTCTGGACGAAGAATACTTCACAACCTTCGGCTACACCCGCCATCAACGCCCGGAGCAACTAGGC
GAAGAATCCATCCTGCTATCAGACGACAACCTCCAAACCACCCTACGCACTTCCTCAGCCAAAACCCCAAACACG
GATTCTCTCAAAACCTACGCCCGCTCTATAAAAGCCCTCTGGACAAGCGAATCTGCCCGAAACGCAGGAATAATC
TACCTCGAAGAAGGAATCCACTCCTTCACCCTATCAACAGGCGCAAAATTCACTCTTTACGCTTCCCCCTACCAA
CCAGAATTCTACAACTGGGCCTTCGCATACCCTCGCGACCAAGACCGCTACAACCCCGCCCCCGCCGCACTCCCA
CAGCCTCAAAATCCAATCCCGGATTACCCGGCCATCGACATCCTACTAACCCACGGCCCGCCCGCCGGGGTCCTG
GATCAGGTCCCTCCTGATTTGAGCGTTGGATGTGAGCATCTCCTCCGCGCGGCGCGGCGCGCAAGGCCACGACTG
CATCTCTTCGGTCATATCCATGAAGGGTGGGGTGCACAGCGCGGAGTGTGGGATGATAAGGCGGGTGGAGATGGA
GATGGTGGTGTTAGACTTGAAGATGTGGCGACGGATATGGAGGAGATGTTAGAGAATCGCGGAGCGTTCTGTGAT
GTTAGTGCTGGGGCGGATCGGCCGCTGCGGGTTGGGGAGGAGACGCTTTTTGTTAATGGGAGTATTATGACGGTC
GCGTATGAGGCGAGGAATGCGCCTTGGGTAGTGGATTTAGAGCTCCCTGTTGCTGGGGCATAG
Transcript >Pro_DTO377G3_2|g6184.t1
ATGGCGACCATCAAGACTCGCATCTGTATGATATCAGACACTCATACAAGCACACCACACCCACCTCAAAGAACC
GATTATGCCTACCGCTATCCACTCCCGAAAGCAAACATCCTCCTCCACGCCGGCGACCTCACAAAGGTGGGGTAC
CGCGTCGAGCACGAAGCAATGATCGCCATGCTCATCGACGCCGACGCCGAGCTCAAGCTCGTAATAGCAGGCAAC
CACGATATAACTCTGGACGAAGAATACTTCACAACCTTCGGCTACACCCGCCATCAACGCCCGGAGCAACTAGGC
GAAGAATCCATCCTGCTATCAGACGACAACCTCCAAACCACCCTACGCACTTCCTCAGCCAAAACCCCAAACACG
GATTCTCTCAAAACCTACGCCCGCTCTATAAAAGCCCTCTGGACAAGCGAATCTGCCCGAAACGCAGGAATAATC
TACCTCGAAGAAGGAATCCACTCCTTCACCCTATCAACAGGCGCAAAATTCACTCTTTACGCTTCCCCCTACCAA
CCAGAATTCTACAACTGGGCCTTCGCATACCCTCGCGACCAAGACCGCTACAACCCCGCCCCCGCCGCACTCCCA
CAGCCTCAAAATCCAATCCCGGATTACCCGGCCATCGACATCCTACTAACCCACGGCCCGCCCGCCGGGGTCCTG
GATCAGGTCCCTCCTGATTTGAGCGTTGGATGTGAGCATCTCCTCCGCGCGGCGCGGCGCGCAAGGCCACGACTG
CATCTCTTCGGTCATATCCATGAAGGGTGGGGTGCACAGCGCGGAGTGTGGGATGATAAGGCGGGTGGAGATGGA
GATGGTGGTGTTAGACTTGAAGATGTGGCGACGGATATGGAGGAGATGTTAGAGAATCGCGGAGCGTTCTGTGAT
GTTAGTGCTGGGGCGGATCGGCCGCTGCGGGTTGGGGAGGAGACGCTTTTTGTTAATGGGAGTATTATGACGGTC
GCGTATGAGGCGAGGAATGCGCCTTGGGTAGTGGATTTAGAGCTCCCTGTTGCTGGGGCATAG
Gene >Pro_DTO377G3_2|g6184.t1
ATGGCGACCATCAAGACTCGCATCTGTATGATATCAGACACTCATACAAGCACACCACACCCACCTCAAAGAACC
GATTATGCCTACCGCTATCCACTCCCGAAAGCAAACATCCTCCTCCACGCCGGCGACCTCACAAAGGTGGGGTAC
CGCGTCGAGCACGAAGCAATGATCGCCATGCTCATCGACGCCGACGCCGAGCTCAAGCTCGTAATAGCAGGCAAC
CACGATATAACTCTGGACGAAGAATACTTCACAACCTTCGGCTACACCCGCCATCAACGCCCGGAGCAACTAGGC
GAAGAATCCATCCTGCTATCAGACGACAACCTCCAAACCACCCTACGCACTTCCTCAGCCAAAACCCCAAACACG
GATTCTCTCAAAACCTACGCCCGCTCTATAAAAGCCCTCTGGACAAGCGAATCTGCCCGAAACGCAGGAATAATC
TACCTCGAAGAAGGAATCCACTCCTTCACCCTATCAACAGGCGCAAAATTCACTCTTTACGCTTCCCCCTACCAA
CCAGAATTCTACAACTGGGCCTTCGCATACCCTCGCGACCAAGACCGCTACAACCCCGCCCCCGCCGCACTCCCA
CAGCCTCAAAATCCAATCCCGGATTACCCGGCCATCGACATCCTACTAACCCACGGCCCGCCCGCCGGGGTCCTG
GATCAGGTCCCTCCTGATTTGAGCGTTGGATGTGAGCATCTCCTCCGCGCGGCGCGGCGCGCAAGGCCACGACTG
CATCTCTTCGGTCATATCCATGAAGGGTGGGGTGCACAGCGCGGAGTGTGGGATGATAAGGCGGGTGGAGATGGA
GATGGTGGTGTTAGACTTGAAGATGTGGCGACGGATATGGAGGAGATGTTAGAGAATCGCGGAGCGTTCTGTGAT
GTTAGTGCTGGGGCGGATCGGCCGCTGCGGGTTGGGGAGGAGACGCTTTTTGTTAATGGGAGTATTATGACGGTC
GCGTATGAGGCGAGGAATGCGCCTTGGGTAGTGGATTTAGAGCTCCCTGTTGCTGGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail