Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6179.t1
Gene name
Locationscaffold_16:158060..160393
Strand-
Gene length (bp)2333
Transcript length (bp)2223
Coding sequence length (bp)2223
Protein length (aa) 741

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.7E-17 47 116
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.8E-17 135 202
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.2E-19 228 296
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.7E-08 331 368
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.7E-06 424 460
PF00658 PABP Poly-adenylate binding protein, unique domain 1.3E-28 645 709
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.7E-03 32 123
PF13893 RRM_5 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.4E-02 133 214

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 73.14 44.89 101.40
5d_25C Five days - 25 degrees Celsius 80.67 49.16 112.18
7d_25C Seven days - 25 degrees Celsius 101.26 61.55 140.96
10d_25C Ten days - 25 degrees Celsius 101.74 60.66 142.83
7d_15C Seven days - 15 degrees Celsius 95.35 58.25 132.45
7d_30C Seven days - 30 degrees Celsius 93.25 56.87 129.63

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.731631 no
3d_25C 7d_25C 0.132943 no
3d_25C 7d_15C 0.241077 no
3d_25C 7d_30C 0.289651 no
3d_25C 10d_25C 0.134450 no
5d_25C 7d_25C 0.341928 no
5d_25C 7d_15C 0.513810 no
5d_25C 7d_30C 0.582790 no
5d_25C 10d_25C 0.343855 no
7d_25C 7d_15C 0.847375 no
7d_25C 7d_30C 0.778570 no
7d_25C 10d_25C 0.990082 no
7d_15C 7d_30C 0.948504 no
7d_15C 10d_25C 0.844652 no
7d_30C 10d_25C 0.775534 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6179.t1
MSAEAPATAPVTDNVVAATPEANGAPVEATSEAAGDAANNQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIR
VCRDAVTRRSLGYAYVNYNNTADGERALEDLNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDNAIDNKALH
DTFAAFGNILSCKVAQDEFANSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDRQSKFEEMKANF
TNIYIKNIDLEITDDEFRVMFEAFGEITSATLSHDQDGKSRGFGFVNYANHESAEAAVAEMNEKDVKTQKLYVGR
AQKKHEREEELRKQYEAARMEKASKYQGVNLYVKNLTDDIDDEKLRDLFTPYGTITSAKVMRDAAERSPSPEAEE
KEADKETKDSEEKEVKTEESTEAKTEEPTEEKKTEEEGEDTEEKKTEKKAFGKSKGFGFVCFSSPDEASKAVTEM
NQRMVNAKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPFMQPAVFYGAGQQGFMPPGQRGGMPF
APQGGMPMPNMPAGRPQYPGPFPQGGRGMPPNQQLPPNFQGMPMGMQAPGGIPNGMGYPMPQAFGRGGGGRGVPG
MPMNMRGGPGFGRGGPQMGRGGGRGQPAPGGQPAGGEPASANQALLTAPPAQQKQMLGEALYPKIQAQQPELAGK
ITGMLLEMDNAELLGLLDDEEALRGKVDEALNVYDEYMKNKGDGETTEPKPQEAAKEAPVEENKS*
Coding >Pro_DTO377G3_2|g6179.t1
ATGTCTGCTGAAGCCCCCGCCACCGCTCCTGTCACTGACAACGTTGTCGCCGCTACCCCTGAGGCCAATGGCGCC
CCCGTCGAGGCCACTTCCGAGGCCGCCGGTGATGCTGCCAACAACCAGCCCCACTCGGCTTCCCTCTACGTCGGC
GAGCTTGACCCCTCCGTGACTGAGGCTATGCTCTACGAGCTATTCTCTTCCATCGGCCAGGTCGCCTCTATCCGT
GTCTGCCGTGATGCCGTCACCCGCCGGTCCTTGGGCTACGCCTACGTCAACTACAACAACACCGCTGACGGCGAG
CGTGCTCTTGAGGATCTGAACTACACTCTCATCAAGGGAAAGCCTTGCCGCATCATGTGGTCCCAGCGTGACCCC
GCTCTGCGCAAGACTGGCCAGGGCAACGTGTTCATCAAGAACCTTGACAACGCCATTGACAACAAGGCTCTCCAC
GACACCTTCGCTGCCTTCGGCAACATTCTCAGCTGCAAGGTCGCCCAGGATGAGTTCGCCAACTCCAAGGGCTAC
GGTTTCGTCCACTACGAGACCGCCGAAGCCGCCAACAACGCCATCAAGCACGTTAACGGTATGCTGCTGAATGAC
AAGAAGGTCTTCGTCGGACACCACATCTCCAAGAAGGACCGCCAAAGCAAGTTCGAGGAGATGAAGGCCAACTTC
ACCAACATCTACATCAAGAACATCGATCTCGAGATTACCGACGACGAGTTCCGCGTCATGTTCGAGGCCTTTGGT
GAGATCACCTCCGCCACCCTCAGCCACGACCAGGATGGCAAGAGCCGCGGTTTCGGCTTTGTTAACTACGCCAAC
CACGAGAGCGCCGAGGCCGCTGTGGCTGAGATGAACGAGAAGGACGTCAAGACTCAGAAGCTTTACGTTGGCCGT
GCCCAGAAGAAGCACGAGCGTGAGGAGGAGCTGCGCAAGCAGTACGAGGCTGCCCGCATGGAGAAGGCCTCCAAG
TACCAGGGTGTCAACCTCTACGTTAAGAACTTGACCGACGACATTGATGATGAGAAGCTCCGTGACCTCTTCACT
CCTTACGGTACTATCACTTCCGCCAAGGTTATGCGTGATGCCGCCGAACGTTCTCCCTCCCCCGAGGCCGAGGAG
AAGGAGGCCGACAAGGAGACCAAGGACTCCGAGGAGAAGGAGGTGAAGACCGAGGAGAGCACCGAGGCGAAGACT
GAGGAGCCTACCGAGGAGAAGAAGACCGAGGAGGAGGGCGAGGACACCGAGGAGAAGAAGACAGAGAAGAAGGCC
TTCGGTAAGAGCAAGGGCTTCGGTTTCGTCTGCTTCAGCAGCCCCGATGAGGCTTCCAAGGCTGTCACCGAGATG
AACCAGCGTATGGTCAACGCCAAGCCCCTCTACGTTGCTCTCGCTCAGCGCAAGGATGTCCGCCGCAGCCAGCTC
GAGGCTAGCATCCAGGCTCGCAACACTATCCGCCAGCAGCAGGCCGCAGCCGCTGCCGGTATGCCCCAGCCTTTC
ATGCAGCCCGCCGTCTTCTACGGTGCTGGCCAGCAGGGCTTCATGCCCCCTGGACAGCGTGGTGGTATGCCATTC
GCCCCCCAGGGCGGTATGCCCATGCCTAACATGCCCGCTGGACGTCCCCAGTACCCCGGTCCCTTCCCCCAAGGT
GGTCGTGGTATGCCCCCCAACCAACAGCTTCCTCCCAACTTCCAGGGTATGCCTATGGGCATGCAGGCCCCTGGT
GGCATTCCTAACGGCATGGGCTACCCTATGCCCCAGGCTTTCGGACGTGGCGGCGGTGGCCGTGGTGTTCCCGGT
ATGCCCATGAACATGCGTGGTGGCCCCGGTTTCGGCCGTGGTGGTCCTCAGATGGGTCGTGGTGGTGGTCGCGGC
CAGCCCGCCCCTGGTGGTCAGCCCGCTGGTGGCGAGCCCGCCTCTGCCAACCAGGCTCTTCTCACCGCTCCCCCC
GCTCAGCAGAAGCAGATGCTCGGCGAGGCTCTTTACCCCAAGATCCAGGCTCAGCAGCCCGAGCTTGCTGGCAAG
ATCACTGGTATGCTTCTTGAGATGGATAACGCTGAGTTGCTTGGCCTGCTCGATGATGAGGAGGCTCTCCGCGGC
AAGGTCGATGAGGCCCTTAACGTCTATGATGAGTACATGAAGAACAAGGGTGATGGCGAGACCACCGAACCCAAG
CCCCAGGAAGCCGCCAAGGAGGCCCCTGTTGAGGAGAACAAGTCTTAA
Transcript >Pro_DTO377G3_2|g6179.t1
ATGTCTGCTGAAGCCCCCGCCACCGCTCCTGTCACTGACAACGTTGTCGCCGCTACCCCTGAGGCCAATGGCGCC
CCCGTCGAGGCCACTTCCGAGGCCGCCGGTGATGCTGCCAACAACCAGCCCCACTCGGCTTCCCTCTACGTCGGC
GAGCTTGACCCCTCCGTGACTGAGGCTATGCTCTACGAGCTATTCTCTTCCATCGGCCAGGTCGCCTCTATCCGT
GTCTGCCGTGATGCCGTCACCCGCCGGTCCTTGGGCTACGCCTACGTCAACTACAACAACACCGCTGACGGCGAG
CGTGCTCTTGAGGATCTGAACTACACTCTCATCAAGGGAAAGCCTTGCCGCATCATGTGGTCCCAGCGTGACCCC
GCTCTGCGCAAGACTGGCCAGGGCAACGTGTTCATCAAGAACCTTGACAACGCCATTGACAACAAGGCTCTCCAC
GACACCTTCGCTGCCTTCGGCAACATTCTCAGCTGCAAGGTCGCCCAGGATGAGTTCGCCAACTCCAAGGGCTAC
GGTTTCGTCCACTACGAGACCGCCGAAGCCGCCAACAACGCCATCAAGCACGTTAACGGTATGCTGCTGAATGAC
AAGAAGGTCTTCGTCGGACACCACATCTCCAAGAAGGACCGCCAAAGCAAGTTCGAGGAGATGAAGGCCAACTTC
ACCAACATCTACATCAAGAACATCGATCTCGAGATTACCGACGACGAGTTCCGCGTCATGTTCGAGGCCTTTGGT
GAGATCACCTCCGCCACCCTCAGCCACGACCAGGATGGCAAGAGCCGCGGTTTCGGCTTTGTTAACTACGCCAAC
CACGAGAGCGCCGAGGCCGCTGTGGCTGAGATGAACGAGAAGGACGTCAAGACTCAGAAGCTTTACGTTGGCCGT
GCCCAGAAGAAGCACGAGCGTGAGGAGGAGCTGCGCAAGCAGTACGAGGCTGCCCGCATGGAGAAGGCCTCCAAG
TACCAGGGTGTCAACCTCTACGTTAAGAACTTGACCGACGACATTGATGATGAGAAGCTCCGTGACCTCTTCACT
CCTTACGGTACTATCACTTCCGCCAAGGTTATGCGTGATGCCGCCGAACGTTCTCCCTCCCCCGAGGCCGAGGAG
AAGGAGGCCGACAAGGAGACCAAGGACTCCGAGGAGAAGGAGGTGAAGACCGAGGAGAGCACCGAGGCGAAGACT
GAGGAGCCTACCGAGGAGAAGAAGACCGAGGAGGAGGGCGAGGACACCGAGGAGAAGAAGACAGAGAAGAAGGCC
TTCGGTAAGAGCAAGGGCTTCGGTTTCGTCTGCTTCAGCAGCCCCGATGAGGCTTCCAAGGCTGTCACCGAGATG
AACCAGCGTATGGTCAACGCCAAGCCCCTCTACGTTGCTCTCGCTCAGCGCAAGGATGTCCGCCGCAGCCAGCTC
GAGGCTAGCATCCAGGCTCGCAACACTATCCGCCAGCAGCAGGCCGCAGCCGCTGCCGGTATGCCCCAGCCTTTC
ATGCAGCCCGCCGTCTTCTACGGTGCTGGCCAGCAGGGCTTCATGCCCCCTGGACAGCGTGGTGGTATGCCATTC
GCCCCCCAGGGCGGTATGCCCATGCCTAACATGCCCGCTGGACGTCCCCAGTACCCCGGTCCCTTCCCCCAAGGT
GGTCGTGGTATGCCCCCCAACCAACAGCTTCCTCCCAACTTCCAGGGTATGCCTATGGGCATGCAGGCCCCTGGT
GGCATTCCTAACGGCATGGGCTACCCTATGCCCCAGGCTTTCGGACGTGGCGGCGGTGGCCGTGGTGTTCCCGGT
ATGCCCATGAACATGCGTGGTGGCCCCGGTTTCGGCCGTGGTGGTCCTCAGATGGGTCGTGGTGGTGGTCGCGGC
CAGCCCGCCCCTGGTGGTCAGCCCGCTGGTGGCGAGCCCGCCTCTGCCAACCAGGCTCTTCTCACCGCTCCCCCC
GCTCAGCAGAAGCAGATGCTCGGCGAGGCTCTTTACCCCAAGATCCAGGCTCAGCAGCCCGAGCTTGCTGGCAAG
ATCACTGGTATGCTTCTTGAGATGGATAACGCTGAGTTGCTTGGCCTGCTCGATGATGAGGAGGCTCTCCGCGGC
AAGGTCGATGAGGCCCTTAACGTCTATGATGAGTACATGAAGAACAAGGGTGATGGCGAGACCACCGAACCCAAG
CCCCAGGAAGCCGCCAAGGAGGCCCCTGTTGAGGAGAACAAGTCTTAA
Gene >Pro_DTO377G3_2|g6179.t1
ATGTCTGCTGAAGCCCCCGCCACCGCTCCTGTCACTGACAACGTTGTCGCCGCTACCCCTGAGGCCAATGGCGCC
CCCGTCGAGGCCACTTCCGAGGCCGCCGGTGATGCTGCCAACAACCAGCCCCACTCGGCTTCCCTCTACGTCGGC
GAGCTTGACCCCTCCGTGACTGAGGCTATGCTCTACGAGCTATTCTCTTCCATCGGCCAGGTCGCCTCTATCCGT
GTCTGCCGTGATGCCGTCACCCGCCGGTCCTTGGGCTACGCCTACGTCAACTACAACAACACCGCTGACGGCGAG
CGTGCTCTTGAGGATCTGAACTACACTCTCATCAAGGGAAAGCCTTGCCGCATCATGTGGTCCCAGCGTGACCCC
GCTCTGCGCAAGACTGGCCAGGGCAACGTGTTCATCAAGAACCTTGACAACGCCATTGACAACAAGGCTCTCCAC
GACACCTTCGCTGCCTTCGGCAACATTCTCAGCTGCAAGGTCGCCCAGGATGAGTTCGCCAACTCCAAGGGCTAC
GGTTTCGTCCACTACGAGACCGCCGAAGCCGCCAACAACGCCATCAAGCACGTTAACGGTATGCTGCTGAATGAC
AAGAAGGTCTTCGTCGGACACCACATCTCCAAGAAGGACCGCCAAAGCAAGTTCGAGGAGATGAAGGCCAACTTC
ACCAACATCTACATCAAGAACATCGATCTCGAGATTACCGACGACGAGTTCCGCGTCATGTTCGAGGCCTTTGGT
GAGATCACCTCCGCCACCCTCAGCCACGACCAGGATGGCAAGAGCCGCGGTTTCGGCTTTGTTAACTACGCCAAC
CACGAGAGCGCCGAGGCCGCTGTGGCTGAGATGAACGAGAAGGACGTCAAGACTCAGAAGCTTTACGTTGGCCGT
GCCCAGAAGAAGCACGAGCGTGAGGAGGAGCTGCGCAAGCAGTACGAGGCTGCCCGCATGGAGAAGGCCTCCAAG
TACCAGGGTGTCAACCTCTACGTTAAGAACTTGACCGACGACATTGATGATGAGAAGCTCCGTGACCTCTTCACT
CCTTACGGTACTATCACTTCCGCCAAGGTTATGCGTGATGCCGCCGAACGTTCTCCCTCCCCCGAGGCCGAGGAG
AAGGAGGCCGACAAGGAGACCAAGGACTCCGAGGAGAAGGAGGTGAAGACCGAGGAGAGCACCGAGGCGAAGACT
GAGGAGCCTACCGAGGAGAAGAAGACCGAGGAGGAGGGCGAGGACACCGAGGAGAAGAAGACAGAGAAGAAGGCC
TTCGGTAAGAGCAAGGGCTTCGGTTTCGTCTGCTTCAGCAGCCCCGATGAGGCTTCCAAGGCTGTCACCGAGATG
AACCAGCGTATGGTCAACGCCAAGCCCCTCTACGTTGCTCTCGCTCAGCGCAAGGATGTCCGCCGCAGCCAGCTC
GAGGCTAGCATCCAGGCTCGCAACACTATCCGCCAGCAGCAGGCCGCAGCCGCTGCCGGTATGCCCCAGCCTGTA
AGTTGCAACTTTCCTGTTCAGCCCGCTCAATTACTAACTTGACTAGTTCATGCAGCCCGCCGTCTTCTACGGTGC
TGGCCAGCAGGGCTTCATGCCCCCTGGACAGCGTGGTGGTATGCCATTCGCCCCCCAGGGCGGTATGCCCATGCC
TAACATGCCCGCTGGACGTCCCCAGTACCCCGGTCCCTTCCCCCAAGGTGGTCGTGGTATGCCCCCCAACCAACA
GCTTCCTCCCAACTTCCAGGGTATGCCTATGGGCATGCAGGCCCCTGGTGGCATTCCTAACGGCATGGGCTACCC
TATGCCCCAGGCTTTCGGACGTGGCGGCGGTGGCCGTGGTGTTCCCGGTATGCCCATGAACATGCGTGGTGGCCC
CGGTTTCGGCCGTGGTGGTCCTCAGATGGGTCGTGGTGGTGGTCGCGGCCAGCCCGCCCCTGGTGGTCAGCCCGC
TGGTGGCGAGCCCGCCTCTGCCAACCAGGCTCTTCTCACCGCTCCCCCCGCTCAGCAGAAGCAGATGCTCGGCGA
GGCTCTTTACCCCAAGATCCAGGCTCAGCAGCCCGAGCTTGCTGGCAAGATCACTGGTATGCTTCTTGAGATGGA
TAACGCTGAGTTGCTTGGCCTGTAAGTTACACTGCCCATTTTTTTGAGTTATGTGTGACAAGATTTACTAACATT
CTTCCAGGCTCGATGATGAGGAGGCTCTCCGCGGCAAGGTCGATGAGGCCCTTAACGTCTATGATGAGTACATGA
AGAACAAGGGTGATGGCGAGACCACCGAACCCAAGCCCCAGGAAGCCGCCAAGGAGGCCCCTGTTGAGGAGAACA
AGTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail