Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6158.t1
Gene name
Locationscaffold_16:109405..110275
Strand+
Gene length (bp)870
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 1.1E-10 75 144
PF09011 HMG_box_2 HMG-box domain 1.3E-05 72 143

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6158.t1
MRLMEVQSYIADLGKAYVQHVNNITEGRDANIELPLGPSGFMGPDFLFRAGSPGAKSEAGGPKKRKRAPVDPNAP
KRALTPYFLYMQHNRSKIAADLGNDARPKDVADEGTRRWQSMEDTQKEVWKKMYAANYDQYKRDMAAYKASNKVE
EDHDPAANQLQQDFAGAEPEAEAEAGVEGEAEHEESAEESTESSDESQSPSPVKEKTPPRSTTKRRRSDTKAKEA
ETPAKSPVKRGRKAAEPVSTPAVKTPAENKRRTKKRKSEV*
Coding >Pro_DTO377G3_2|g6158.t1
ATGCGCCTCATGGAGGTGCAGTCTTACATTGCTGACCTAGGCAAGGCCTACGTCCAGCATGTAAACAACATCACC
GAAGGACGCGATGCCAACATTGAGCTCCCCCTCGGTCCCTCTGGATTCATGGGCCCGGATTTTCTTTTCCGTGCC
GGCAGCCCCGGTGCTAAGTCTGAGGCTGGTGGCCCCAAGAAGCGCAAGCGCGCGCCCGTCGACCCCAACGCGCCC
AAGCGTGCCTTGACACCCTACTTCTTGTATATGCAGCACAACCGCAGCAAGATCGCCGCCGACTTGGGCAATGAT
GCGCGCCCCAAGGATGTCGCCGACGAGGGCACCCGGCGCTGGCAGAGCATGGAAGATACCCAGAAGGAGGTCTGG
AAGAAGATGTATGCCGCCAACTACGACCAGTACAAGCGCGATATGGCAGCCTACAAGGCCAGCAACAAGGTTGAG
GAGGACCACGATCCCGCAGCCAACCAACTGCAACAGGACTTTGCCGGTGCCGAGCCCGAGGCTGAGGCTGAGGCT
GGGGTCGAGGGTGAGGCTGAGCACGAGGAGTCTGCCGAGGAGTCCACCGAATCATCCGACGAGTCGCAGTCCCCG
TCTCCCGTGAAGGAAAAGACCCCGCCGCGCAGCACCACCAAGCGCCGCCGCAGTGATACCAAGGCCAAGGAAGCC
GAGACTCCTGCCAAGTCGCCTGTCAAGCGGGGTCGCAAGGCTGCGGAGCCGGTGTCAACACCGGCTGTCAAGACA
CCGGCTGAAAACAAGCGTAGGACCAAGAAGCGCAAGAGCGAGGTGTAA
Transcript >Pro_DTO377G3_2|g6158.t1
ATGCGCCTCATGGAGGTGCAGTCTTACATTGCTGACCTAGGCAAGGCCTACGTCCAGCATGTAAACAACATCACC
GAAGGACGCGATGCCAACATTGAGCTCCCCCTCGGTCCCTCTGGATTCATGGGCCCGGATTTTCTTTTCCGTGCC
GGCAGCCCCGGTGCTAAGTCTGAGGCTGGTGGCCCCAAGAAGCGCAAGCGCGCGCCCGTCGACCCCAACGCGCCC
AAGCGTGCCTTGACACCCTACTTCTTGTATATGCAGCACAACCGCAGCAAGATCGCCGCCGACTTGGGCAATGAT
GCGCGCCCCAAGGATGTCGCCGACGAGGGCACCCGGCGCTGGCAGAGCATGGAAGATACCCAGAAGGAGGTCTGG
AAGAAGATGTATGCCGCCAACTACGACCAGTACAAGCGCGATATGGCAGCCTACAAGGCCAGCAACAAGGTTGAG
GAGGACCACGATCCCGCAGCCAACCAACTGCAACAGGACTTTGCCGGTGCCGAGCCCGAGGCTGAGGCTGAGGCT
GGGGTCGAGGGTGAGGCTGAGCACGAGGAGTCTGCCGAGGAGTCCACCGAATCATCCGACGAGTCGCAGTCCCCG
TCTCCCGTGAAGGAAAAGACCCCGCCGCGCAGCACCACCAAGCGCCGCCGCAGTGATACCAAGGCCAAGGAAGCC
GAGACTCCTGCCAAGTCGCCTGTCAAGCGGGGTCGCAAGGCTGCGGAGCCGGTGTCAACACCGGCTGTCAAGACA
CCGGCTGAAAACAAGCGTAGGACCAAGAAGCGCAAGAGCGAGGTGTAA
Gene >Pro_DTO377G3_2|g6158.t1
ATGCGCCTCATGGAGGTGCAGTCTTACATTGCTGACCTAGGCAAGGCCTACGTCCAGCATGTAAACAACATCACC
GAAGGACGCGATGCCAACATTGAGCTCCCCCTCGGTCCCTCTGGATTCATGGGCCCGGATTTTCTTTTCCGTGCC
GGCAGCCCCGGTGCTAAGTCTGAGGCTGGTGGCCCCAAGAAGCGCAAGCGCGCGCCCGTCGACCCCAACGCGCCC
AAGCGTGCCTTGACACCCTACTTCTTGTATATGCAGCACAACCGCAGCAAGATCGCCGCCGACTTGGGCAATGAT
GCGCGCCCCAAGGATGTCGCCGACGAGGGCACCCGGCGCTGGCAGAGCATGGAAGATACCCAGAAGGAGGTATGT
ATTGGCATCAAATCAGTTCCAGCTTAGTATTGTACTCAAGAATACAGAGCTAACCCATTCGCATAGGTCTGGAAG
AAGATGTATGCCGCCAACTACGACCAGTACAAGCGCGATATGGCAGCCTACAAGGCCAGCAACAAGGTTGAGGAG
GACCACGATCCCGCAGCCAACCAACTGCAACAGGACTTTGCCGGTGCCGAGCCCGAGGCTGAGGCTGAGGCTGGG
GTCGAGGGTGAGGCTGAGCACGAGGAGTCTGCCGAGGAGTCCACCGAATCATCCGACGAGTCGCAGTCCCCGTCT
CCCGTGAAGGAAAAGACCCCGCCGCGCAGCACCACCAAGCGCCGCCGCAGTGATACCAAGGCCAAGGAAGCCGAG
ACTCCTGCCAAGTCGCCTGTCAAGCGGGGTCGCAAGGCTGCGGAGCCGGTGTCAACACCGGCTGTCAAGACACCG
GCTGAAAACAAGCGTAGGACCAAGAAGCGCAAGAGCGAGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail