Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6157.t1
Gene name
Locationscaffold_16:106567..107684
Strand+
Gene length (bp)1117
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 3.8E-33 182 290
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 2.0E-21 73 169
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 5.7E-05 177 221

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 315.85 190.63 441.06
5d_25C Five days - 25 degrees Celsius 179.04 109.02 249.06
7d_25C Seven days - 25 degrees Celsius 155.73 94.82 216.64
10d_25C Ten days - 25 degrees Celsius 108.66 64.58 152.74
7d_15C Seven days - 15 degrees Celsius 262.62 158.11 367.13
7d_30C Seven days - 30 degrees Celsius 97.23 58.42 136.03

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.006000 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.477085 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.602276 no
5d_25C 7d_15C 0.080925 no
5d_25C 7d_30C 0.002297 yes
5d_25C 10d_25C 0.018560 yes
7d_25C 7d_15C 0.013810 yes
7d_25C 7d_30C 0.024170 yes
7d_25C 10d_25C 0.108807 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.703795 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6157.t1
MFARQSFRCVQPLKQGFRKYSAEAAPKKSNLAPIYVGVGLAGLGAGLYRYSTGAVAEPKDRPKVFNGEDWVDLKL
ANIEILSPNAKRLRFEYDDKEAVSGLPVASALLTRFKPEGAEKNILRPYTPTSDEDIPGYLELVVKSYPGGPMSE
HIHSMNVNQRLSFKGPLIKYPWEANKHDHICLIAGGTGITPMYQLAREIFKNPEDKTKVTLVFGNVTEEDILLKK
ELHDLENTYPQRFRAFYVLDKPPAEWTGGKGFITKELLKTVLPEPKEENIKIFVCGPPPMYKAISGAKVSPKDQG
ELTGILKDLGYSKDQVFKF*
Coding >Pro_DTO377G3_2|g6157.t1
ATGTTTGCTCGTCAATCTTTCCGTTGTGTGCAGCCCTTGAAGCAGGGTTTCCGCAAATACTCTGCGGAGGCCGCT
CCCAAGAAGTCCAACTTGGCCCCCATCTACGTTGGTGTGGGCCTCGCCGGTCTCGGTGCTGGTTTGTACCGCTAC
AGCACCGGCGCGGTCGCTGAGCCCAAGGACCGCCCCAAGGTCTTCAACGGCGAGGACTGGGTTGATCTCAAGTTG
GCTAATATTGAAATCCTGAGCCCCAACGCCAAGCGTCTTCGCTTCGAGTATGATGATAAGGAAGCTGTCTCTGGC
CTTCCTGTTGCTTCTGCTCTGTTGACTCGTTTCAAGCCCGAGGGTGCCGAGAAGAACATTCTCCGTCCTTATACC
CCCACTAGTGATGAGGATATCCCCGGTTACCTTGAACTTGTTGTCAAGTCCTACCCCGGCGGCCCTATGTCTGAG
CACATCCATTCCATGAACGTCAACCAGCGCCTGTCGTTCAAGGGTCCTCTTATCAAGTATCCCTGGGAGGCCAAC
AAGCACGACCACATTTGCCTGATCGCCGGTGGTACTGGTATCACCCCGATGTACCAGCTCGCTCGTGAGATCTTC
AAGAACCCCGAGGACAAGACCAAGGTCACTTTGGTCTTCGGCAATGTCACCGAGGAGGATATCCTCCTGAAGAAG
GAGCTGCATGATTTGGAGAACACTTACCCCCAGCGCTTCCGTGCCTTCTACGTCCTGGACAAGCCCCCTGCGGAG
TGGACCGGTGGCAAGGGTTTCATCACCAAGGAGCTGCTGAAGACCGTTCTGCCGGAGCCCAAGGAGGAGAACATC
AAGATTTTCGTCTGTGGCCCTCCCCCCATGTACAAGGCTATCTCCGGTGCTAAGGTCAGCCCCAAGGACCAGGGT
GAGCTCACTGGTATCTTGAAGGATCTGGGTTACAGCAAGGACCAGGTCTTCAAGTTCTAG
Transcript >Pro_DTO377G3_2|g6157.t1
ATGTTTGCTCGTCAATCTTTCCGTTGTGTGCAGCCCTTGAAGCAGGGTTTCCGCAAATACTCTGCGGAGGCCGCT
CCCAAGAAGTCCAACTTGGCCCCCATCTACGTTGGTGTGGGCCTCGCCGGTCTCGGTGCTGGTTTGTACCGCTAC
AGCACCGGCGCGGTCGCTGAGCCCAAGGACCGCCCCAAGGTCTTCAACGGCGAGGACTGGGTTGATCTCAAGTTG
GCTAATATTGAAATCCTGAGCCCCAACGCCAAGCGTCTTCGCTTCGAGTATGATGATAAGGAAGCTGTCTCTGGC
CTTCCTGTTGCTTCTGCTCTGTTGACTCGTTTCAAGCCCGAGGGTGCCGAGAAGAACATTCTCCGTCCTTATACC
CCCACTAGTGATGAGGATATCCCCGGTTACCTTGAACTTGTTGTCAAGTCCTACCCCGGCGGCCCTATGTCTGAG
CACATCCATTCCATGAACGTCAACCAGCGCCTGTCGTTCAAGGGTCCTCTTATCAAGTATCCCTGGGAGGCCAAC
AAGCACGACCACATTTGCCTGATCGCCGGTGGTACTGGTATCACCCCGATGTACCAGCTCGCTCGTGAGATCTTC
AAGAACCCCGAGGACAAGACCAAGGTCACTTTGGTCTTCGGCAATGTCACCGAGGAGGATATCCTCCTGAAGAAG
GAGCTGCATGATTTGGAGAACACTTACCCCCAGCGCTTCCGTGCCTTCTACGTCCTGGACAAGCCCCCTGCGGAG
TGGACCGGTGGCAAGGGTTTCATCACCAAGGAGCTGCTGAAGACCGTTCTGCCGGAGCCCAAGGAGGAGAACATC
AAGATTTTCGTCTGTGGCCCTCCCCCCATGTACAAGGCTATCTCCGGTGCTAAGGTCAGCCCCAAGGACCAGGGT
GAGCTCACTGGTATCTTGAAGGATCTGGGTTACAGCAAGGACCAGGTCTTCAAGTTCTAG
Gene >Pro_DTO377G3_2|g6157.t1
ATGTTTGCTCGTCAATCTTTCCGTTGTGTGCAGCCCTTGAAGCAGGTAAGTTGAAAAGGGTTCTCAATTGAATCC
CCATACTAAAACCGTTCAATCAGGGTTTCCGCAAATACTCTGCGGAGGCCGCTCCCAAGAAGTCCAACTTGGCCC
CCATCTACGTTGGTGTGGGCCTCGCCGGTCTCGGTGCTGGTTTGTACCGCTACAGCACCGGCGCGGTCGCTGAGC
CCAAGGACCGCCCCAAGGTCTTCAACGGCGAGGACTGGGTTGATCTCAAGTTGGCTAATATTGAAATCCTGAGCC
CCAACGCCAAGCGTCTTCGCTTCGAGTATGATGATAAGGAAGCTGTCTCTGGCCTTCCTGTTGCTTGTGAGTAGT
CTGACTCCGAGCATGGTTACCAATCAATCACTAACAGGAATCTAGCTGCTCTGTTGACTCGTTTCAAGCCCGAGG
GTGCCGAGAAGAACATTCTCCGTCCTTATACCCCCACTAGTGATGAGGGTAGGAAATCATAAAATGCGACTTAGT
TTTCAAATGCTAACACATAGCAGATATCCCCGGTTACCTTGAACTTGTTGTCAAGTCCTACCCCGGCGGCCCTAT
GTCTGAGCACATCCATTCCATGAACGTCAACCAGCGCCTGTCGTTCAAGGGTCCTCTTATCAAGTATCCCTGGGA
GGCCAACAAGCACGACCACATTTGCCTGATCGCCGGTGGTACTGGTATCACCCCGATGTACCAGCTCGCTCGTGA
GATCTTCAAGAACCCCGAGGACAAGACCAAGGTCACTTTGGTCTTCGGCAATGTCACCGAGGAGGATATCCTCCT
GAAGAAGGAGCTGCATGATTTGGAGAACACTTACCCCCAGCGCTTCCGTGCCTTCTACGTCCTGGACAAGCCCCC
TGCGGAGTGGACCGGTGGCAAGGGTTTCATCACCAAGGAGCTGCTGAAGACCGTTCTGCCGGAGCCCAAGGAGGA
GAACATCAAGATTTTCGTCTGTGGCCCTCCCCCCATGTACAAGGCTATCTCCGGTGCTAAGGTCAGCCCCAAGGA
CCAGGGTGAGCTCACTGGTATCTTGAAGGATCTGGGTTACAGCAAGGACCAGGTCTTCAAGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail