Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g6144.t1
Gene name
Locationscaffold_16:77762..80228
Strand+
Gene length (bp)2466
Transcript length (bp)2466
Coding sequence length (bp)2466
Protein length (aa) 822

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06472 ABC_membrane_2 ABC transporter transmembrane region 2 5.5E-88 157 425
PF00005 ABC_tran ABC transporter 6.6E-11 553 697

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0030554 adenyl nucleotide binding No
GO:0005575 cellular_component No
GO:0015399 primary active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 70.60 43.14 98.06
5d_25C Five days - 25 degrees Celsius 93.24 56.25 130.22
7d_25C Seven days - 25 degrees Celsius 94.34 56.10 132.58
10d_25C Ten days - 25 degrees Celsius 142.15 83.30 200.99
7d_15C Seven days - 15 degrees Celsius 112.39 65.60 159.19
7d_30C Seven days - 30 degrees Celsius 95.34 57.00 133.69

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.229627 no
3d_25C 7d_25C 0.208854 no
3d_25C 7d_15C 0.024417 yes
3d_25C 7d_30C 0.183818 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.973209 no
5d_25C 7d_15C 0.475254 no
5d_25C 7d_30C 0.949575 no
5d_25C 10d_25C 0.053316 no
7d_25C 7d_15C 0.514844 no
7d_25C 7d_30C 0.977427 no
7d_25C 10d_25C 0.064169 no
7d_15C 7d_30C 0.541747 no
7d_15C 10d_25C 0.353611 no
7d_30C 10d_25C 0.067601 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g6144.t1
MAVQSTLRRPEDPLLTLYRHYSDLIRSKFHRTSKTTRLIATIALLFSIIGSGYGGYTWFRARAKERAQGSRLLRR
NSGIRGKDGSRTIYVPYKDSLTSKVLIHPTKPTTFDAHRRLFLNPPASSRSKDDGSASQIPPPTTKPGLNLAFLH
QFLSLGSIMVPRWGSKETGLLMSHGLFLLMRTYLSLLIARLDGEIVRDLVAGKGRAFLWGIFKWCGIGTLASYTN
AMIKFLQSKVSIAFRTRLTRYIHDLYLTDNNNYYKLMNLDGGIGQGPDQFITQDLTLFCSAAASLYSSMGKPLVD
LFVFNYQLYRSLGPLALSGILAGYFSTAVVLRKLSPPFGKLKAVEGKKEGDFRGLHSRLLANAEEISFYGGADTE
RVFLVRSFKELQRWMEGIYSLKIRYNMLEDMILKYSWSAFGYLITSLPIFLPAWGGSGGAMELADVSEGMGRERG
RMKEFITNKRLMLSLADAGGRMMYSIKDISELAGYTSRVYGLIATLHRVHADAYYTPRGSHPELYSLADVQGTTH
NGFNGVRLEQVPIVAPSLYPMGGDELIESLSFIVHSGDHLLISGPNGVGKSAIPRIVAGLWPVYRGLVSRPRGFG
LDGIMFLPQRPYLSVGTLRDQVIYPHTELDMREAGETDAALQKILDDAHLGYLPQREGGWDARKEWKDVLSGGEK
QRMGMARLFYHEPRYAFMDEGTSAVSSDVEGLLYDNAKERGITLITISTRASLKKYHTYNLTLGLGAEGEAWEFE
RIGTEKEKLGVEKELQELRMRLDKVDEWKQRREEIDQELQKVWANGSEVAPPPYQEAEHSSSEALTGVTAN*
Coding >Pro_DTO377G3_2|g6144.t1
ATGGCCGTCCAGTCAACCCTTCGGCGTCCGGAGGATCCCCTCCTGACATTATATCGCCATTACTCCGATCTCATA
CGCTCCAAGTTCCACCGCACATCCAAAACCACCCGCTTGATTGCAACGATAGCCCTTCTTTTCTCCATCATCGGC
TCGGGTTATGGAGGCTATACGTGGTTCCGAGCGAGAGCCAAGGAGCGGGCCCAGGGTAGCCGTCTATTACGCCGA
AACTCTGGTATCCGGGGCAAGGATGGATCTCGAACTATATACGTGCCATACAAGGACTCCCTGACTTCCAAGGTC
TTGATCCATCCCACCAAACCGACTACTTTTGACGCTCATCGACGACTATTCCTCAACCCCCCGGCATCGAGTCGC
AGCAAAGATGATGGCTCAGCAAGCCAGATCCCTCCCCCTACAACCAAACCAGGTCTGAATTTGGCATTCTTGCAT
CAATTCTTGAGTTTGGGTAGTATCATGGTCCCCAGATGGGGGAGCAAAGAGACTGGGTTGCTGATGAGCCACGGC
CTTTTTCTCTTGATGAGAACATATCTTTCACTGTTGATTGCACGGCTTGACGGTGAGATTGTAAGAGATTTGGTC
GCTGGGAAAGGAAGGGCTTTCCTTTGGGGTATCTTCAAGTGGTGTGGAATTGGAACCCTTGCTTCATATACCAAT
GCGATGATCAAATTCCTTCAATCCAAGGTGTCCATCGCCTTCCGCACTCGATTGACCCGATATATCCACGACCTA
TACCTAACTGACAATAACAATTACTATAAATTGATGAACTTGGACGGCGGAATCGGTCAAGGGCCCGATCAATTT
ATCACGCAGGATCTTACCCTGTTCTGCTCGGCTGCCGCATCACTATACTCCTCAATGGGAAAGCCGTTAGTGGAT
CTTTTCGTATTCAACTACCAACTTTACCGATCCCTCGGCCCCCTTGCCCTCAGCGGCATTTTGGCTGGGTACTTT
AGCACAGCCGTGGTGCTCCGGAAACTGTCACCACCATTTGGAAAGCTTAAGGCAGTGGAGGGCAAGAAAGAGGGG
GATTTCCGTGGCCTGCACTCTCGACTTTTAGCCAATGCCGAAGAGATCTCGTTCTACGGCGGAGCCGATACCGAG
CGGGTGTTCCTAGTCCGAAGCTTCAAGGAGCTGCAGCGATGGATGGAGGGCATTTATAGTCTCAAGATCCGCTAC
AACATGCTCGAGGACATGATCCTGAAGTACTCCTGGTCGGCGTTTGGTTATCTGATAACTTCTTTACCCATCTTC
CTCCCCGCCTGGGGTGGCTCGGGTGGTGCAATGGAGTTGGCCGATGTATCCGAGGGTATGGGTCGCGAGCGTGGC
CGCATGAAGGAATTCATCACTAACAAACGTCTCATGCTTTCGCTCGCCGATGCTGGAGGCCGCATGATGTACAGC
ATTAAGGACATATCCGAACTCGCTGGCTACACCTCCCGCGTCTACGGCCTCATTGCCACCTTGCACCGTGTCCAC
GCCGATGCGTATTACACCCCACGGGGCTCGCATCCCGAGCTATATTCCCTTGCGGATGTCCAAGGCACCACCCAC
AACGGCTTCAACGGGGTCCGTCTAGAGCAGGTCCCGATCGTTGCACCATCCCTTTACCCAATGGGCGGCGACGAG
CTCATCGAGTCGCTCTCATTTATCGTCCATTCGGGCGACCACCTCCTTATTTCAGGTCCAAATGGCGTAGGCAAG
TCTGCAATCCCGCGTATTGTGGCCGGGCTCTGGCCTGTATACCGCGGACTGGTTAGTCGCCCTCGGGGCTTCGGC
CTCGACGGAATCATGTTCCTCCCCCAGCGGCCATATCTCAGCGTCGGCACTCTGCGCGATCAAGTGATCTACCCG
CACACGGAGCTTGATATGCGCGAAGCTGGCGAGACAGACGCAGCTCTACAGAAGATTCTCGACGACGCCCATCTT
GGCTACCTGCCACAGCGTGAAGGTGGCTGGGACGCTCGCAAGGAGTGGAAAGATGTTCTAAGTGGTGGTGAAAAG
CAGCGCATGGGCATGGCGCGGCTCTTCTACCATGAGCCGCGGTATGCATTCATGGACGAAGGCACTTCGGCTGTT
TCCTCGGATGTCGAGGGATTGCTGTACGACAACGCCAAGGAGCGAGGTATCACTCTCATCACCATTTCGACGCGG
GCGTCTTTAAAAAAGTACCATACTTATAACCTGACTCTTGGTCTGGGTGCCGAAGGCGAGGCCTGGGAGTTCGAG
AGAATCGGTACTGAGAAGGAGAAGCTTGGTGTTGAGAAAGAACTACAAGAGCTGCGGATGCGTCTGGATAAGGTG
GACGAGTGGAAGCAGCGCCGCGAGGAAATTGATCAGGAGCTTCAGAAGGTGTGGGCTAATGGTAGTGAAGTTGCA
CCGCCGCCTTATCAGGAGGCAGAGCACTCTAGCTCTGAGGCTCTAACTGGGGTAACAGCGAATTAA
Transcript >Pro_DTO377G3_2|g6144.t1
ATGGCCGTCCAGTCAACCCTTCGGCGTCCGGAGGATCCCCTCCTGACATTATATCGCCATTACTCCGATCTCATA
CGCTCCAAGTTCCACCGCACATCCAAAACCACCCGCTTGATTGCAACGATAGCCCTTCTTTTCTCCATCATCGGC
TCGGGTTATGGAGGCTATACGTGGTTCCGAGCGAGAGCCAAGGAGCGGGCCCAGGGTAGCCGTCTATTACGCCGA
AACTCTGGTATCCGGGGCAAGGATGGATCTCGAACTATATACGTGCCATACAAGGACTCCCTGACTTCCAAGGTC
TTGATCCATCCCACCAAACCGACTACTTTTGACGCTCATCGACGACTATTCCTCAACCCCCCGGCATCGAGTCGC
AGCAAAGATGATGGCTCAGCAAGCCAGATCCCTCCCCCTACAACCAAACCAGGTCTGAATTTGGCATTCTTGCAT
CAATTCTTGAGTTTGGGTAGTATCATGGTCCCCAGATGGGGGAGCAAAGAGACTGGGTTGCTGATGAGCCACGGC
CTTTTTCTCTTGATGAGAACATATCTTTCACTGTTGATTGCACGGCTTGACGGTGAGATTGTAAGAGATTTGGTC
GCTGGGAAAGGAAGGGCTTTCCTTTGGGGTATCTTCAAGTGGTGTGGAATTGGAACCCTTGCTTCATATACCAAT
GCGATGATCAAATTCCTTCAATCCAAGGTGTCCATCGCCTTCCGCACTCGATTGACCCGATATATCCACGACCTA
TACCTAACTGACAATAACAATTACTATAAATTGATGAACTTGGACGGCGGAATCGGTCAAGGGCCCGATCAATTT
ATCACGCAGGATCTTACCCTGTTCTGCTCGGCTGCCGCATCACTATACTCCTCAATGGGAAAGCCGTTAGTGGAT
CTTTTCGTATTCAACTACCAACTTTACCGATCCCTCGGCCCCCTTGCCCTCAGCGGCATTTTGGCTGGGTACTTT
AGCACAGCCGTGGTGCTCCGGAAACTGTCACCACCATTTGGAAAGCTTAAGGCAGTGGAGGGCAAGAAAGAGGGG
GATTTCCGTGGCCTGCACTCTCGACTTTTAGCCAATGCCGAAGAGATCTCGTTCTACGGCGGAGCCGATACCGAG
CGGGTGTTCCTAGTCCGAAGCTTCAAGGAGCTGCAGCGATGGATGGAGGGCATTTATAGTCTCAAGATCCGCTAC
AACATGCTCGAGGACATGATCCTGAAGTACTCCTGGTCGGCGTTTGGTTATCTGATAACTTCTTTACCCATCTTC
CTCCCCGCCTGGGGTGGCTCGGGTGGTGCAATGGAGTTGGCCGATGTATCCGAGGGTATGGGTCGCGAGCGTGGC
CGCATGAAGGAATTCATCACTAACAAACGTCTCATGCTTTCGCTCGCCGATGCTGGAGGCCGCATGATGTACAGC
ATTAAGGACATATCCGAACTCGCTGGCTACACCTCCCGCGTCTACGGCCTCATTGCCACCTTGCACCGTGTCCAC
GCCGATGCGTATTACACCCCACGGGGCTCGCATCCCGAGCTATATTCCCTTGCGGATGTCCAAGGCACCACCCAC
AACGGCTTCAACGGGGTCCGTCTAGAGCAGGTCCCGATCGTTGCACCATCCCTTTACCCAATGGGCGGCGACGAG
CTCATCGAGTCGCTCTCATTTATCGTCCATTCGGGCGACCACCTCCTTATTTCAGGTCCAAATGGCGTAGGCAAG
TCTGCAATCCCGCGTATTGTGGCCGGGCTCTGGCCTGTATACCGCGGACTGGTTAGTCGCCCTCGGGGCTTCGGC
CTCGACGGAATCATGTTCCTCCCCCAGCGGCCATATCTCAGCGTCGGCACTCTGCGCGATCAAGTGATCTACCCG
CACACGGAGCTTGATATGCGCGAAGCTGGCGAGACAGACGCAGCTCTACAGAAGATTCTCGACGACGCCCATCTT
GGCTACCTGCCACAGCGTGAAGGTGGCTGGGACGCTCGCAAGGAGTGGAAAGATGTTCTAAGTGGTGGTGAAAAG
CAGCGCATGGGCATGGCGCGGCTCTTCTACCATGAGCCGCGGTATGCATTCATGGACGAAGGCACTTCGGCTGTT
TCCTCGGATGTCGAGGGATTGCTGTACGACAACGCCAAGGAGCGAGGTATCACTCTCATCACCATTTCGACGCGG
GCGTCTTTAAAAAAGTACCATACTTATAACCTGACTCTTGGTCTGGGTGCCGAAGGCGAGGCCTGGGAGTTCGAG
AGAATCGGTACTGAGAAGGAGAAGCTTGGTGTTGAGAAAGAACTACAAGAGCTGCGGATGCGTCTGGATAAGGTG
GACGAGTGGAAGCAGCGCCGCGAGGAAATTGATCAGGAGCTTCAGAAGGTGTGGGCTAATGGTAGTGAAGTTGCA
CCGCCGCCTTATCAGGAGGCAGAGCACTCTAGCTCTGAGGCTCTAACTGGGGTAACAGCGAATTAA
Gene >Pro_DTO377G3_2|g6144.t1
ATGGCCGTCCAGTCAACCCTTCGGCGTCCGGAGGATCCCCTCCTGACATTATATCGCCATTACTCCGATCTCATA
CGCTCCAAGTTCCACCGCACATCCAAAACCACCCGCTTGATTGCAACGATAGCCCTTCTTTTCTCCATCATCGGC
TCGGGTTATGGAGGCTATACGTGGTTCCGAGCGAGAGCCAAGGAGCGGGCCCAGGGTAGCCGTCTATTACGCCGA
AACTCTGGTATCCGGGGCAAGGATGGATCTCGAACTATATACGTGCCATACAAGGACTCCCTGACTTCCAAGGTC
TTGATCCATCCCACCAAACCGACTACTTTTGACGCTCATCGACGACTATTCCTCAACCCCCCGGCATCGAGTCGC
AGCAAAGATGATGGCTCAGCAAGCCAGATCCCTCCCCCTACAACCAAACCAGGTCTGAATTTGGCATTCTTGCAT
CAATTCTTGAGTTTGGGTAGTATCATGGTCCCCAGATGGGGGAGCAAAGAGACTGGGTTGCTGATGAGCCACGGC
CTTTTTCTCTTGATGAGAACATATCTTTCACTGTTGATTGCACGGCTTGACGGTGAGATTGTAAGAGATTTGGTC
GCTGGGAAAGGAAGGGCTTTCCTTTGGGGTATCTTCAAGTGGTGTGGAATTGGAACCCTTGCTTCATATACCAAT
GCGATGATCAAATTCCTTCAATCCAAGGTGTCCATCGCCTTCCGCACTCGATTGACCCGATATATCCACGACCTA
TACCTAACTGACAATAACAATTACTATAAATTGATGAACTTGGACGGCGGAATCGGTCAAGGGCCCGATCAATTT
ATCACGCAGGATCTTACCCTGTTCTGCTCGGCTGCCGCATCACTATACTCCTCAATGGGAAAGCCGTTAGTGGAT
CTTTTCGTATTCAACTACCAACTTTACCGATCCCTCGGCCCCCTTGCCCTCAGCGGCATTTTGGCTGGGTACTTT
AGCACAGCCGTGGTGCTCCGGAAACTGTCACCACCATTTGGAAAGCTTAAGGCAGTGGAGGGCAAGAAAGAGGGG
GATTTCCGTGGCCTGCACTCTCGACTTTTAGCCAATGCCGAAGAGATCTCGTTCTACGGCGGAGCCGATACCGAG
CGGGTGTTCCTAGTCCGAAGCTTCAAGGAGCTGCAGCGATGGATGGAGGGCATTTATAGTCTCAAGATCCGCTAC
AACATGCTCGAGGACATGATCCTGAAGTACTCCTGGTCGGCGTTTGGTTATCTGATAACTTCTTTACCCATCTTC
CTCCCCGCCTGGGGTGGCTCGGGTGGTGCAATGGAGTTGGCCGATGTATCCGAGGGTATGGGTCGCGAGCGTGGC
CGCATGAAGGAATTCATCACTAACAAACGTCTCATGCTTTCGCTCGCCGATGCTGGAGGCCGCATGATGTACAGC
ATTAAGGACATATCCGAACTCGCTGGCTACACCTCCCGCGTCTACGGCCTCATTGCCACCTTGCACCGTGTCCAC
GCCGATGCGTATTACACCCCACGGGGCTCGCATCCCGAGCTATATTCCCTTGCGGATGTCCAAGGCACCACCCAC
AACGGCTTCAACGGGGTCCGTCTAGAGCAGGTCCCGATCGTTGCACCATCCCTTTACCCAATGGGCGGCGACGAG
CTCATCGAGTCGCTCTCATTTATCGTCCATTCGGGCGACCACCTCCTTATTTCAGGTCCAAATGGCGTAGGCAAG
TCTGCAATCCCGCGTATTGTGGCCGGGCTCTGGCCTGTATACCGCGGACTGGTTAGTCGCCCTCGGGGCTTCGGC
CTCGACGGAATCATGTTCCTCCCCCAGCGGCCATATCTCAGCGTCGGCACTCTGCGCGATCAAGTGATCTACCCG
CACACGGAGCTTGATATGCGCGAAGCTGGCGAGACAGACGCAGCTCTACAGAAGATTCTCGACGACGCCCATCTT
GGCTACCTGCCACAGCGTGAAGGTGGCTGGGACGCTCGCAAGGAGTGGAAAGATGTTCTAAGTGGTGGTGAAAAG
CAGCGCATGGGCATGGCGCGGCTCTTCTACCATGAGCCGCGGTATGCATTCATGGACGAAGGCACTTCGGCTGTT
TCCTCGGATGTCGAGGGATTGCTGTACGACAACGCCAAGGAGCGAGGTATCACTCTCATCACCATTTCGACGCGG
GCGTCTTTAAAAAAGTACCATACTTATAACCTGACTCTTGGTCTGGGTGCCGAAGGCGAGGCCTGGGAGTTCGAG
AGAATCGGTACTGAGAAGGAGAAGCTTGGTGTTGAGAAAGAACTACAAGAGCTGCGGATGCGTCTGGATAAGGTG
GACGAGTGGAAGCAGCGCCGCGAGGAAATTGATCAGGAGCTTCAGAAGGTGTGGGCTAATGGTAGTGAAGTTGCA
CCGCCGCCTTATCAGGAGGCAGAGCACTCTAGCTCTGAGGCTCTAACTGGGGTAACAGCGAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail